Anti B3GNT7 pAb (ATL-HPA035626 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035626-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: B3GNT7
Alternative Gene Name: beta3GnT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079445: 88%, ENSRNOG00000018267: 86%
Entrez Gene ID: 93010
Uniprot ID: Q8NFL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LGMCLEVLGVQPTAHEGFKTFGISRNRNSRMNKEPCFFRAMLVVHKLLPPELLAMWGLVHSNLTCSRKLQVL |
Gene Sequence | LGMCLEVLGVQPTAHEGFKTFGISRNRNSRMNKEPCFFRAMLVVHKLLPPELLAMWGLVHSNLTCSRKLQVL |
Gene ID - Mouse | ENSMUSG00000079445 |
Gene ID - Rat | ENSRNOG00000018267 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti B3GNT7 pAb (ATL-HPA035626 w/enhanced validation) | |
Datasheet | Anti B3GNT7 pAb (ATL-HPA035626 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti B3GNT7 pAb (ATL-HPA035626 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti B3GNT7 pAb (ATL-HPA035626 w/enhanced validation) | |
Datasheet | Anti B3GNT7 pAb (ATL-HPA035626 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti B3GNT7 pAb (ATL-HPA035626 w/enhanced validation) |