Anti B3GNT7 pAb (ATL-HPA035626 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA035626-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7
Gene Name: B3GNT7
Alternative Gene Name: beta3GnT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079445: 88%, ENSRNOG00000018267: 86%
Entrez Gene ID: 93010
Uniprot ID: Q8NFL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGMCLEVLGVQPTAHEGFKTFGISRNRNSRMNKEPCFFRAMLVVHKLLPPELLAMWGLVHSNLTCSRKLQVL
Gene Sequence LGMCLEVLGVQPTAHEGFKTFGISRNRNSRMNKEPCFFRAMLVVHKLLPPELLAMWGLVHSNLTCSRKLQVL
Gene ID - Mouse ENSMUSG00000079445
Gene ID - Rat ENSRNOG00000018267
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti B3GNT7 pAb (ATL-HPA035626 w/enhanced validation)
Datasheet Anti B3GNT7 pAb (ATL-HPA035626 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti B3GNT7 pAb (ATL-HPA035626 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti B3GNT7 pAb (ATL-HPA035626 w/enhanced validation)
Datasheet Anti B3GNT7 pAb (ATL-HPA035626 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti B3GNT7 pAb (ATL-HPA035626 w/enhanced validation)