Anti B3GNT7 pAb (ATL-HPA035626 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035626-25

Protein Description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7
Gene Name: B3GNT7
Alternative Gene Name: beta3GnT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079445: 88%, ENSRNOG00000018267: 86%
Entrez Gene ID: 93010
Uniprot ID: Q8NFL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGMCLEVLGVQPTAHEGFKTFGISRNRNSRMNKEPCFFRAMLVVHKLLPPELLAMWGLVHSNLTCSRKLQVL
• Gene Sequence: LGMCLEVLGVQPTAHEGFKTFGISRNRNSRMNKEPCFFRAMLVVHKLLPPELLAMWGLVHSNLTCSRKLQVL
• Gene ID - Mouse: ENSMUSG00000079445
• Gene ID - Rat: ENSRNOG00000018267
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.