Anti B3GNT7 pAb (ATL-HPA013881)

Atlas Antibodies

SKU:
ATL-HPA013881-100
  • Immunofluorescent staining of human cell line HEL shows localization to the Golgi apparatus.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7
Gene Name: B3GNT7
Alternative Gene Name: beta3GnT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079445: 89%, ENSRNOG00000018267: 89%
Entrez Gene ID: 93010
Uniprot ID: Q8NFL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KWLDIYCPHVPFIFKGDDDVFVNPTNLLEFLADRQPQENLFVGDVLQHARPIRRKDNKYYIPGALYGKASYPPYAGGGGFLMAGSLARRLHHACDTLELYPIDDVFLGMCLEVLGVQPTAHEGFKTFGISRNRNSRMNKEPCF
Gene Sequence KWLDIYCPHVPFIFKGDDDVFVNPTNLLEFLADRQPQENLFVGDVLQHARPIRRKDNKYYIPGALYGKASYPPYAGGGGFLMAGSLARRLHHACDTLELYPIDDVFLGMCLEVLGVQPTAHEGFKTFGISRNRNSRMNKEPCF
Gene ID - Mouse ENSMUSG00000079445
Gene ID - Rat ENSRNOG00000018267
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti B3GNT7 pAb (ATL-HPA013881)
Datasheet Anti B3GNT7 pAb (ATL-HPA013881) Datasheet (External Link)
Vendor Page Anti B3GNT7 pAb (ATL-HPA013881) at Atlas Antibodies

Documents & Links for Anti B3GNT7 pAb (ATL-HPA013881)
Datasheet Anti B3GNT7 pAb (ATL-HPA013881) Datasheet (External Link)
Vendor Page Anti B3GNT7 pAb (ATL-HPA013881)