Anti B3GNT5 pAb (ATL-HPA017292)

Atlas Antibodies

SKU:
ATL-HPA017292-25
  • Immunohistochemical staining of human liver shows moderate granular positivity in hepatocytes.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5
Gene Name: B3GNT5
Alternative Gene Name: B3GN-T5, beta3Gn-T5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022686: 87%, ENSRNOG00000046258: 86%
Entrez Gene ID: 84002
Uniprot ID: Q9BYG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GAPPIRDKSSKYYVSYEMYQWPAYPDYTAGAAYVISGDVAAKVYEASQTLNSSLYIDDVFMGLCANKIGIVPQDHVFFSGEGKTPYHPCIYEKMMTSHGHLEDLQDLWKNATDPKV
Gene Sequence GAPPIRDKSSKYYVSYEMYQWPAYPDYTAGAAYVISGDVAAKVYEASQTLNSSLYIDDVFMGLCANKIGIVPQDHVFFSGEGKTPYHPCIYEKMMTSHGHLEDLQDLWKNATDPKV
Gene ID - Mouse ENSMUSG00000022686
Gene ID - Rat ENSRNOG00000046258
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti B3GNT5 pAb (ATL-HPA017292)
Datasheet Anti B3GNT5 pAb (ATL-HPA017292) Datasheet (External Link)
Vendor Page Anti B3GNT5 pAb (ATL-HPA017292) at Atlas Antibodies

Documents & Links for Anti B3GNT5 pAb (ATL-HPA017292)
Datasheet Anti B3GNT5 pAb (ATL-HPA017292) Datasheet (External Link)
Vendor Page Anti B3GNT5 pAb (ATL-HPA017292)