Anti B3GNT4 pAb (ATL-HPA055261)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055261-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: B3GNT4
Alternative Gene Name: B3GN-T4, beta3Gn-T4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029431: 74%, ENSRNOG00000008544: 76%
Entrez Gene ID: 79369
Uniprot ID: Q9C0J1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TAHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFLLLAIK |
| Gene Sequence | TAHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFLLLAIK |
| Gene ID - Mouse | ENSMUSG00000029431 |
| Gene ID - Rat | ENSRNOG00000008544 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti B3GNT4 pAb (ATL-HPA055261) | |
| Datasheet | Anti B3GNT4 pAb (ATL-HPA055261) Datasheet (External Link) |
| Vendor Page | Anti B3GNT4 pAb (ATL-HPA055261) at Atlas Antibodies |
| Documents & Links for Anti B3GNT4 pAb (ATL-HPA055261) | |
| Datasheet | Anti B3GNT4 pAb (ATL-HPA055261) Datasheet (External Link) |
| Vendor Page | Anti B3GNT4 pAb (ATL-HPA055261) |