Anti B3GNT4 pAb (ATL-HPA055261)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055261-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: B3GNT4
Alternative Gene Name: B3GN-T4, beta3Gn-T4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029431: 74%, ENSRNOG00000008544: 76%
Entrez Gene ID: 79369
Uniprot ID: Q9C0J1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TAHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFLLLAIK |
Gene Sequence | TAHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFLLLAIK |
Gene ID - Mouse | ENSMUSG00000029431 |
Gene ID - Rat | ENSRNOG00000008544 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti B3GNT4 pAb (ATL-HPA055261) | |
Datasheet | Anti B3GNT4 pAb (ATL-HPA055261) Datasheet (External Link) |
Vendor Page | Anti B3GNT4 pAb (ATL-HPA055261) at Atlas Antibodies |
Documents & Links for Anti B3GNT4 pAb (ATL-HPA055261) | |
Datasheet | Anti B3GNT4 pAb (ATL-HPA055261) Datasheet (External Link) |
Vendor Page | Anti B3GNT4 pAb (ATL-HPA055261) |