Anti B3GNT4 pAb (ATL-HPA055261)

Atlas Antibodies

Catalog No.: ATL-HPA055261-25

Protein Description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
Gene Name: B3GNT4
Alternative Gene Name: B3GN-T4, beta3Gn-T4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029431: 74%, ENSRNOG00000008544: 76%
Entrez Gene ID: 79369
Uniprot ID: Q9C0J1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TAHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFLLLAIK
• Gene Sequence: TAHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFLLLAIK
• Gene ID - Mouse: ENSMUSG00000029431
• Gene ID - Rat: ENSRNOG00000008544
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.