Anti B3GNT3 pAb (ATL-HPA024298 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024298-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: B3GNT3
Alternative Gene Name: B3GN-T3, B3GNT-3, beta3Gn-T3, HP10328, TMEM3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031803: 75%, ENSRNOG00000018764: 73%
Entrez Gene ID: 10331
Uniprot ID: Q9Y2A9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLQDVPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQDHDPGRHLFV |
| Gene Sequence | LLQDVPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQDHDPGRHLFV |
| Gene ID - Mouse | ENSMUSG00000031803 |
| Gene ID - Rat | ENSRNOG00000018764 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti B3GNT3 pAb (ATL-HPA024298 w/enhanced validation) | |
| Datasheet | Anti B3GNT3 pAb (ATL-HPA024298 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti B3GNT3 pAb (ATL-HPA024298 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti B3GNT3 pAb (ATL-HPA024298 w/enhanced validation) | |
| Datasheet | Anti B3GNT3 pAb (ATL-HPA024298 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti B3GNT3 pAb (ATL-HPA024298 w/enhanced validation) |
| Citations for Anti B3GNT3 pAb (ATL-HPA024298 w/enhanced validation) – 1 Found |
| Clark, A T R; Guimarães da Costa, V M L; Bandeira Costa, L; Bezerra Cavalcanti, C L; De Melo Rêgo, M J B; Beltrão, E I C. Differential expression patterns of N-acetylglucosaminyl transferases and polylactosamines in uterine lesions. European Journal Of Histochemistry : Ejh. 2014;58(2):2334. PubMed |