Anti B3GNT3 pAb (ATL-HPA024298 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA024298-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3
Gene Name: B3GNT3
Alternative Gene Name: B3GN-T3, B3GNT-3, beta3Gn-T3, HP10328, TMEM3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031803: 75%, ENSRNOG00000018764: 73%
Entrez Gene ID: 10331
Uniprot ID: Q9Y2A9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLQDVPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQDHDPGRHLFV
Gene Sequence LLQDVPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQDHDPGRHLFV
Gene ID - Mouse ENSMUSG00000031803
Gene ID - Rat ENSRNOG00000018764
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti B3GNT3 pAb (ATL-HPA024298 w/enhanced validation)
Datasheet Anti B3GNT3 pAb (ATL-HPA024298 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti B3GNT3 pAb (ATL-HPA024298 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti B3GNT3 pAb (ATL-HPA024298 w/enhanced validation)
Datasheet Anti B3GNT3 pAb (ATL-HPA024298 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti B3GNT3 pAb (ATL-HPA024298 w/enhanced validation)
Citations for Anti B3GNT3 pAb (ATL-HPA024298 w/enhanced validation) – 1 Found
Clark, A T R; Guimarães da Costa, V M L; Bandeira Costa, L; Bezerra Cavalcanti, C L; De Melo Rêgo, M J B; Beltrão, E I C. Differential expression patterns of N-acetylglucosaminyl transferases and polylactosamines in uterine lesions. European Journal Of Histochemistry : Ejh. 2014;58(2):2334.  PubMed