Anti B3GNT2 pAb (ATL-HPA005997)

Atlas Antibodies

SKU:
ATL-HPA005997-100
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
  • Western blot analysis in human cell line BEWO.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
Gene Name: B3GNT2
Alternative Gene Name: B3GN-T1, B3GN-T2, B3GNT-2, B3GNT1, BETA3GNT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051650: 92%, ENSRNOG00000009267: 93%
Entrez Gene ID: 10678
Uniprot ID: Q9NY97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMI
Gene Sequence DTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMI
Gene ID - Mouse ENSMUSG00000051650
Gene ID - Rat ENSRNOG00000009267
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti B3GNT2 pAb (ATL-HPA005997)
Datasheet Anti B3GNT2 pAb (ATL-HPA005997) Datasheet (External Link)
Vendor Page Anti B3GNT2 pAb (ATL-HPA005997) at Atlas Antibodies

Documents & Links for Anti B3GNT2 pAb (ATL-HPA005997)
Datasheet Anti B3GNT2 pAb (ATL-HPA005997) Datasheet (External Link)
Vendor Page Anti B3GNT2 pAb (ATL-HPA005997)