Anti B3GAT3 pAb (ATL-HPA051328)

Atlas Antibodies

Catalog No.:
ATL-HPA051328-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: beta-1,3-glucuronyltransferase 3
Gene Name: B3GAT3
Alternative Gene Name: GlcAT-I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071649: 95%, ENSRNOG00000019804: 94%
Entrez Gene ID: 26229
Uniprot ID: O94766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVY
Gene Sequence AASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVY
Gene ID - Mouse ENSMUSG00000071649
Gene ID - Rat ENSRNOG00000019804
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti B3GAT3 pAb (ATL-HPA051328)
Datasheet Anti B3GAT3 pAb (ATL-HPA051328) Datasheet (External Link)
Vendor Page Anti B3GAT3 pAb (ATL-HPA051328) at Atlas Antibodies

Documents & Links for Anti B3GAT3 pAb (ATL-HPA051328)
Datasheet Anti B3GAT3 pAb (ATL-HPA051328) Datasheet (External Link)
Vendor Page Anti B3GAT3 pAb (ATL-HPA051328)