Anti B3GAT3 pAb (ATL-HPA051328)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051328-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: B3GAT3
Alternative Gene Name: GlcAT-I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071649: 95%, ENSRNOG00000019804: 94%
Entrez Gene ID: 26229
Uniprot ID: O94766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVY |
| Gene Sequence | AASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVY |
| Gene ID - Mouse | ENSMUSG00000071649 |
| Gene ID - Rat | ENSRNOG00000019804 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti B3GAT3 pAb (ATL-HPA051328) | |
| Datasheet | Anti B3GAT3 pAb (ATL-HPA051328) Datasheet (External Link) |
| Vendor Page | Anti B3GAT3 pAb (ATL-HPA051328) at Atlas Antibodies |
| Documents & Links for Anti B3GAT3 pAb (ATL-HPA051328) | |
| Datasheet | Anti B3GAT3 pAb (ATL-HPA051328) Datasheet (External Link) |
| Vendor Page | Anti B3GAT3 pAb (ATL-HPA051328) |