Anti B3GAT1 pAb (ATL-HPA074314)

Atlas Antibodies

Catalog No.:
ATL-HPA074314-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: beta-1,3-glucuronyltransferase 1
Gene Name: B3GAT1
Alternative Gene Name: CD57, GlcAT-P, HNK-1, LEU7, NK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045994: 100%, ENSRNOG00000007142: 100%
Entrez Gene ID: 27087
Uniprot ID: Q9P2W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVVEDAPRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRN
Gene Sequence LVVEDAPRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRN
Gene ID - Mouse ENSMUSG00000045994
Gene ID - Rat ENSRNOG00000007142
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti B3GAT1 pAb (ATL-HPA074314)
Datasheet Anti B3GAT1 pAb (ATL-HPA074314) Datasheet (External Link)
Vendor Page Anti B3GAT1 pAb (ATL-HPA074314) at Atlas Antibodies

Documents & Links for Anti B3GAT1 pAb (ATL-HPA074314)
Datasheet Anti B3GAT1 pAb (ATL-HPA074314) Datasheet (External Link)
Vendor Page Anti B3GAT1 pAb (ATL-HPA074314)