Anti B3GAT1 pAb (ATL-HPA069468)

Atlas Antibodies

Catalog No.: ATL-HPA069468-25

Protein Description: beta-1,3-glucuronyltransferase 1
Gene Name: B3GAT1
Alternative Gene Name: CD57, GlcAT-P, HNK-1, LEU7, NK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045994: 95%, ENSRNOG00000007142: 95%
Entrez Gene ID: 27087
Uniprot ID: Q9P2W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTEYVYTRPPPWSDTLPTI
• Gene Sequence: LLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTEYVYTRPPPWSDTLPTI
• Gene ID - Mouse: ENSMUSG00000045994
• Gene ID - Rat: ENSRNOG00000007142
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti B3GAT1 pAb (ATL-HPA069468) – 1 Found

Trimarco, Joseph D; Nelson, Sarah L; Chaparian, Ryan R; Wells, Alexandra I; Murray, Nathan B; Azadi, Parastoo; Coyne, Carolyn B; Heaton, Nicholas S. Cellular glycan modification by B3GAT1 broadly restricts influenza virus infection. Nature Communications. 2022;13(1):6456.