Anti B3GAT1 pAb (ATL-HPA069468)
Atlas Antibodies
- SKU:
- ATL-HPA069468-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: B3GAT1
Alternative Gene Name: CD57, GlcAT-P, HNK-1, LEU7, NK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045994: 95%, ENSRNOG00000007142: 95%
Entrez Gene ID: 27087
Uniprot ID: Q9P2W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTEYVYTRPPPWSDTLPTI |
Gene Sequence | LLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTEYVYTRPPPWSDTLPTI |
Gene ID - Mouse | ENSMUSG00000045994 |
Gene ID - Rat | ENSRNOG00000007142 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti B3GAT1 pAb (ATL-HPA069468) | |
Datasheet | Anti B3GAT1 pAb (ATL-HPA069468) Datasheet (External Link) |
Vendor Page | Anti B3GAT1 pAb (ATL-HPA069468) at Atlas Antibodies |
Documents & Links for Anti B3GAT1 pAb (ATL-HPA069468) | |
Datasheet | Anti B3GAT1 pAb (ATL-HPA069468) Datasheet (External Link) |
Vendor Page | Anti B3GAT1 pAb (ATL-HPA069468) |
Citations for Anti B3GAT1 pAb (ATL-HPA069468) – 1 Found |
Trimarco, Joseph D; Nelson, Sarah L; Chaparian, Ryan R; Wells, Alexandra I; Murray, Nathan B; Azadi, Parastoo; Coyne, Carolyn B; Heaton, Nicholas S. Cellular glycan modification by B3GAT1 broadly restricts influenza virus infection. Nature Communications. 2022;13(1):6456. PubMed |