Anti B3GALT5 pAb (ATL-HPA054684)

Atlas Antibodies

Catalog No.:
ATL-HPA054684-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Gene Name: B3GALT5
Alternative Gene Name: B3GalT-V, B3T5, beta3Gal-T5, GLCT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074892: 68%, ENSRNOG00000030983: 68%
Entrez Gene ID: 10317
Uniprot ID: Q9Y2C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTW
Gene Sequence YSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTW
Gene ID - Mouse ENSMUSG00000074892
Gene ID - Rat ENSRNOG00000030983
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti B3GALT5 pAb (ATL-HPA054684)
Datasheet Anti B3GALT5 pAb (ATL-HPA054684) Datasheet (External Link)
Vendor Page Anti B3GALT5 pAb (ATL-HPA054684) at Atlas Antibodies

Documents & Links for Anti B3GALT5 pAb (ATL-HPA054684)
Datasheet Anti B3GALT5 pAb (ATL-HPA054684) Datasheet (External Link)
Vendor Page Anti B3GALT5 pAb (ATL-HPA054684)