Anti B3GALT4 pAb (ATL-HPA043001)

Atlas Antibodies

SKU:
ATL-HPA043001-25
  • Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4
Gene Name: B3GALT4
Alternative Gene Name: beta3Gal-T4, GalT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067370: 89%, ENSRNOG00000000471: 88%
Entrez Gene ID: 8705
Uniprot ID: O96024
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGVSARRGGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTAPFCSWFQGVLGILRCRA
Gene Sequence PFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGVSARRGGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTAPFCSWFQGVLGILRCRA
Gene ID - Mouse ENSMUSG00000067370
Gene ID - Rat ENSRNOG00000000471
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti B3GALT4 pAb (ATL-HPA043001)
Datasheet Anti B3GALT4 pAb (ATL-HPA043001) Datasheet (External Link)
Vendor Page Anti B3GALT4 pAb (ATL-HPA043001) at Atlas Antibodies

Documents & Links for Anti B3GALT4 pAb (ATL-HPA043001)
Datasheet Anti B3GALT4 pAb (ATL-HPA043001) Datasheet (External Link)
Vendor Page Anti B3GALT4 pAb (ATL-HPA043001)