Anti B3GALT4 pAb (ATL-HPA043001)

Atlas Antibodies

Catalog No.: ATL-HPA043001-25

Protein Description: UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4
Gene Name: B3GALT4
Alternative Gene Name: beta3Gal-T4, GalT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067370: 89%, ENSRNOG00000000471: 88%
Entrez Gene ID: 8705
Uniprot ID: O96024
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGVSARRGGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTAPFCSWFQGVLGILRCRA
• Gene Sequence: PFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGVSARRGGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTAPFCSWFQGVLGILRCRA
• Gene ID - Mouse: ENSMUSG00000067370
• Gene ID - Rat: ENSRNOG00000000471
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.