Anti B3GALT4 pAb (ATL-HPA043001)
Atlas Antibodies
- SKU:
- ATL-HPA043001-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: B3GALT4
Alternative Gene Name: beta3Gal-T4, GalT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067370: 89%, ENSRNOG00000000471: 88%
Entrez Gene ID: 8705
Uniprot ID: O96024
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGVSARRGGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTAPFCSWFQGVLGILRCRA |
Gene Sequence | PFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGVSARRGGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTAPFCSWFQGVLGILRCRA |
Gene ID - Mouse | ENSMUSG00000067370 |
Gene ID - Rat | ENSRNOG00000000471 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti B3GALT4 pAb (ATL-HPA043001) | |
Datasheet | Anti B3GALT4 pAb (ATL-HPA043001) Datasheet (External Link) |
Vendor Page | Anti B3GALT4 pAb (ATL-HPA043001) at Atlas Antibodies |
Documents & Links for Anti B3GALT4 pAb (ATL-HPA043001) | |
Datasheet | Anti B3GALT4 pAb (ATL-HPA043001) Datasheet (External Link) |
Vendor Page | Anti B3GALT4 pAb (ATL-HPA043001) |