Anti B3GALNT2 pAb (ATL-HPA050662)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050662-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: B3GALNT2
Alternative Gene Name: MGC39558
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039242: 94%, ENSRNOG00000016855: 95%
Entrez Gene ID: 148789
Uniprot ID: Q8NCR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WTVETTSFNLLLKTDDDCYIDLEAVFNRIVQKNLDGPNFWWGNFRLNWAVDRTGKWQELEYPSPAYPAFACGSGYVISKDIVKWLASNSGRLKTYQGEDV |
Gene Sequence | WTVETTSFNLLLKTDDDCYIDLEAVFNRIVQKNLDGPNFWWGNFRLNWAVDRTGKWQELEYPSPAYPAFACGSGYVISKDIVKWLASNSGRLKTYQGEDV |
Gene ID - Mouse | ENSMUSG00000039242 |
Gene ID - Rat | ENSRNOG00000016855 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti B3GALNT2 pAb (ATL-HPA050662) | |
Datasheet | Anti B3GALNT2 pAb (ATL-HPA050662) Datasheet (External Link) |
Vendor Page | Anti B3GALNT2 pAb (ATL-HPA050662) at Atlas Antibodies |
Documents & Links for Anti B3GALNT2 pAb (ATL-HPA050662) | |
Datasheet | Anti B3GALNT2 pAb (ATL-HPA050662) Datasheet (External Link) |
Vendor Page | Anti B3GALNT2 pAb (ATL-HPA050662) |