Anti B3GALNT2 pAb (ATL-HPA050662)

Atlas Antibodies

Catalog No.:
ATL-HPA050662-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: beta-1,3-N-acetylgalactosaminyltransferase 2
Gene Name: B3GALNT2
Alternative Gene Name: MGC39558
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039242: 94%, ENSRNOG00000016855: 95%
Entrez Gene ID: 148789
Uniprot ID: Q8NCR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WTVETTSFNLLLKTDDDCYIDLEAVFNRIVQKNLDGPNFWWGNFRLNWAVDRTGKWQELEYPSPAYPAFACGSGYVISKDIVKWLASNSGRLKTYQGEDV
Gene Sequence WTVETTSFNLLLKTDDDCYIDLEAVFNRIVQKNLDGPNFWWGNFRLNWAVDRTGKWQELEYPSPAYPAFACGSGYVISKDIVKWLASNSGRLKTYQGEDV
Gene ID - Mouse ENSMUSG00000039242
Gene ID - Rat ENSRNOG00000016855
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti B3GALNT2 pAb (ATL-HPA050662)
Datasheet Anti B3GALNT2 pAb (ATL-HPA050662) Datasheet (External Link)
Vendor Page Anti B3GALNT2 pAb (ATL-HPA050662) at Atlas Antibodies

Documents & Links for Anti B3GALNT2 pAb (ATL-HPA050662)
Datasheet Anti B3GALNT2 pAb (ATL-HPA050662) Datasheet (External Link)
Vendor Page Anti B3GALNT2 pAb (ATL-HPA050662)