Anti AZI2 pAb (ATL-HPA035258)

Atlas Antibodies

SKU: ATL-HPA035258-25

• 

Protein Description: 5-azacytidine induced 2
Gene Name: AZI2
Alternative Gene Name: AZ2, FLJ21939, NAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039285: 90%, ENSRNOG00000010096: 87%
Entrez Gene ID: 64343
Uniprot ID: Q9H6S1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKMNKDNSESLKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQT
• Gene Sequence: DKMNKDNSESLKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQT
• Gene ID - Mouse: ENSMUSG00000039285
• Gene ID - Rat: ENSRNOG00000010096
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AZI2 pAb (ATL-HPA035258) – 1 Found

Bozóky, Benedek; Savchenko, Andrii; Csermely, Péter; Korcsmáros, Tamás; Dúl, Zoltán; Pontén, Fredrik; Székely, László; Klein, George. Novel signatures of cancer-associated fibroblasts. International Journal Of Cancer. 2013;133(2):286-93.