Anti AXL pAb (ATL-HPA075217)

Atlas Antibodies

Catalog No.:
ATL-HPA075217-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: AXL receptor tyrosine kinase
Gene Name: AXL
Alternative Gene Name: ARK, JTK11, Tyro7, UFO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002602: 83%, ENSRNOG00000020716: 83%
Entrez Gene ID: 558
Uniprot ID: P30530
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQ
Gene Sequence TATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQ
Gene ID - Mouse ENSMUSG00000002602
Gene ID - Rat ENSRNOG00000020716
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AXL pAb (ATL-HPA075217)
Datasheet Anti AXL pAb (ATL-HPA075217) Datasheet (External Link)
Vendor Page Anti AXL pAb (ATL-HPA075217) at Atlas Antibodies

Documents & Links for Anti AXL pAb (ATL-HPA075217)
Datasheet Anti AXL pAb (ATL-HPA075217) Datasheet (External Link)
Vendor Page Anti AXL pAb (ATL-HPA075217)