Anti AXL pAb (ATL-HPA037423)

Atlas Antibodies

SKU: ATL-HPA037423-25

• 

Protein Description: AXL receptor tyrosine kinase
Gene Name: AXL
Alternative Gene Name: JTK11, UFO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002602: 88%, ENSRNOG00000020716: 88%
Entrez Gene ID: 558
Uniprot ID: P30530
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSL
• Gene Sequence: ESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSL
• Gene ID - Mouse: ENSMUSG00000002602
• Gene ID - Rat: ENSRNOG00000020716
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AXL pAb (ATL-HPA037423) – 2 Found

Liu, Ching-Ann; Harn, Horng-Jyh; Chen, Kuan-Pin; Lee, Jui-Hao; Lin, Shinn-Zong; Chiu, Tsung-Lang. Targeting the Axl and mTOR Pathway Synergizes Immunotherapy and Chemotherapy to Butylidenephthalide in a Recurrent GBM. Journal Of Oncology. 2022( 35646111):3236058. 

Radke, Josefine; Schumann, Elisa; Onken, Julia; Koll, Randi; Acker, Güliz; Bodnar, Bohdan; Senger, Carolin; Tierling, Sascha; Möbs, Markus; Vajkoczy, Peter; Vidal, Anna; Högler, Sandra; Kodajova, Petra; Westphal, Dana; Meier, Friedegund; Heppner, Frank; Kreuzer-Redmer, Susanne; Grebien, Florian; Jürchott, Karsten; Redmer, Torben. Decoding molecular programs in melanoma brain metastases. Nature Communications. 2022;13(1):7304.