Anti AXL pAb (ATL-HPA037422 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA037422-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: AXL receptor tyrosine kinase
Gene Name: AXL
Alternative Gene Name: JTK11, UFO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002602: 84%, ENSRNOG00000020716: 87%
Entrez Gene ID: 558
Uniprot ID: P30530
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ
Gene Sequence PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ
Gene ID - Mouse ENSMUSG00000002602
Gene ID - Rat ENSRNOG00000020716
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AXL pAb (ATL-HPA037422 w/enhanced validation)
Datasheet Anti AXL pAb (ATL-HPA037422 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AXL pAb (ATL-HPA037422 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AXL pAb (ATL-HPA037422 w/enhanced validation)
Datasheet Anti AXL pAb (ATL-HPA037422 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AXL pAb (ATL-HPA037422 w/enhanced validation)
Citations for Anti AXL pAb (ATL-HPA037422 w/enhanced validation) – 5 Found
Wang, Lining; Liu, Kangkang; Yu, Jianpeng; Sun, Erlin. A retrospective analysis of the correlation between AXL expression and clinical outcomes of patients with urothelial bladder carcinoma. Translational Cancer Research. 2019;8(3):976-984.  PubMed
Pinato, D J; Mauri, F A; Lloyd, T; Vaira, V; Casadio, C; Boldorini, R L; Sharma, R. The expression of Axl receptor tyrosine kinase influences the tumour phenotype and clinical outcome of patients with malignant pleural mesothelioma. British Journal Of Cancer. 2013;108(3):621-8.  PubMed
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed
Ong, Chee Wee; Chong, Pei Yi; McArt, Darragh G; Chan, Jason Yongsheng; Tan, Hwee Tong; Kumar, Alan Prem; Chung, Maxey C M; Clément, Marie-Véronique; Soong, Richie; Van Schaeybroeck, Sandra; Waugh, David J J; Johnston, Patrick G; Dunne, Philip D; Salto-Tellez, Manuel. The prognostic value of the stem-like group in colorectal cancer using a panel of immunohistochemistry markers. Oncotarget. 2015;6(14):12763-73.  PubMed
Pinato, David J; Brown, Matthew W; Trousil, Sebastian; Aboagye, Eric O; Beaumont, Jamie; Zhang, Hua; Coley, Helen M; Mauri, Francesco A; Sharma, Rohini. Integrated analysis of multiple receptor tyrosine kinases identifies Axl as a therapeutic target and mediator of resistance to sorafenib in hepatocellular carcinoma. British Journal Of Cancer. 2019;120(5):512-521.  PubMed