Anti AWAT2 pAb (ATL-HPA062748)

Atlas Antibodies

Catalog No.:
ATL-HPA062748-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: acyl-CoA wax alcohol acyltransferase 2
Gene Name: AWAT2
Alternative Gene Name: DGAT2L4, MFAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031220: 94%, ENSRNOG00000003030: 84%
Entrez Gene ID: 158835
Uniprot ID: Q6E213
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLIPAYAFGETDLYDQHIFTPGGFVNRFQKWFQSMVHIYPCAFYGRGFTK
Gene Sequence PLIPAYAFGETDLYDQHIFTPGGFVNRFQKWFQSMVHIYPCAFYGRGFTK
Gene ID - Mouse ENSMUSG00000031220
Gene ID - Rat ENSRNOG00000003030
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AWAT2 pAb (ATL-HPA062748)
Datasheet Anti AWAT2 pAb (ATL-HPA062748) Datasheet (External Link)
Vendor Page Anti AWAT2 pAb (ATL-HPA062748) at Atlas Antibodies

Documents & Links for Anti AWAT2 pAb (ATL-HPA062748)
Datasheet Anti AWAT2 pAb (ATL-HPA062748) Datasheet (External Link)
Vendor Page Anti AWAT2 pAb (ATL-HPA062748)