Anti AWAT2 pAb (ATL-HPA062748)

Atlas Antibodies

Catalog No.: ATL-HPA062748-25

Protein Description: acyl-CoA wax alcohol acyltransferase 2
Gene Name: AWAT2
Alternative Gene Name: DGAT2L4, MFAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031220: 94%, ENSRNOG00000003030: 84%
Entrez Gene ID: 158835
Uniprot ID: Q6E213
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLIPAYAFGETDLYDQHIFTPGGFVNRFQKWFQSMVHIYPCAFYGRGFTK
• Gene Sequence: PLIPAYAFGETDLYDQHIFTPGGFVNRFQKWFQSMVHIYPCAFYGRGFTK
• Gene ID - Mouse: ENSMUSG00000031220
• Gene ID - Rat: ENSRNOG00000003030
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.