Anti AWAT1 pAb (ATL-HPA063412)

Atlas Antibodies

Catalog No.:
ATL-HPA063412-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: acyl-CoA wax alcohol acyltransferase 1
Gene Name: AWAT1
Alternative Gene Name: DGAT2L3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015665: 90%, ENSRNOG00000026231: 90%
Entrez Gene ID: 158833
Uniprot ID: Q58HT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCT
Gene Sequence WVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCT
Gene ID - Mouse ENSMUSG00000015665
Gene ID - Rat ENSRNOG00000026231
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AWAT1 pAb (ATL-HPA063412)
Datasheet Anti AWAT1 pAb (ATL-HPA063412) Datasheet (External Link)
Vendor Page Anti AWAT1 pAb (ATL-HPA063412) at Atlas Antibodies

Documents & Links for Anti AWAT1 pAb (ATL-HPA063412)
Datasheet Anti AWAT1 pAb (ATL-HPA063412) Datasheet (External Link)
Vendor Page Anti AWAT1 pAb (ATL-HPA063412)