Anti AVPI1 pAb (ATL-HPA037649)

Atlas Antibodies

SKU: ATL-HPA037649-100

• 
• 
• 

Protein Description: arginine vasopressin-induced 1
Gene Name: AVPI1
Alternative Gene Name: PP5395, VIP32, VIT32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018821: 87%, ENSRNOG00000014828: 80%
Entrez Gene ID: 60370
Uniprot ID: Q5T686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALKR
• Gene Sequence: ASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALKR
• Gene ID - Mouse: ENSMUSG00000018821
• Gene ID - Rat: ENSRNOG00000014828
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.