Anti AVPI1 pAb (ATL-HPA037649)

Atlas Antibodies

Catalog No.:
ATL-HPA037649-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: arginine vasopressin-induced 1
Gene Name: AVPI1
Alternative Gene Name: PP5395, VIP32, VIT32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018821: 87%, ENSRNOG00000014828: 80%
Entrez Gene ID: 60370
Uniprot ID: Q5T686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALKR
Gene Sequence ASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALKR
Gene ID - Mouse ENSMUSG00000018821
Gene ID - Rat ENSRNOG00000014828
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AVPI1 pAb (ATL-HPA037649)
Datasheet Anti AVPI1 pAb (ATL-HPA037649) Datasheet (External Link)
Vendor Page Anti AVPI1 pAb (ATL-HPA037649) at Atlas Antibodies

Documents & Links for Anti AVPI1 pAb (ATL-HPA037649)
Datasheet Anti AVPI1 pAb (ATL-HPA037649) Datasheet (External Link)
Vendor Page Anti AVPI1 pAb (ATL-HPA037649)