Anti AVIL pAb (ATL-HPA058864)

Atlas Antibodies

Catalog No.: ATL-HPA058864-25

Protein Description: advillin
Gene Name: AVIL
Alternative Gene Name: ADVIL, DOC6, FLJ12386, p92
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025432: 90%, ENSRNOG00000050419: 91%
Entrez Gene ID: 10677
Uniprot ID: O75366
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HASQDELAASAYQAVEVDRQFDGAAVQVRVRMGTEPRHFMAIFKGKLVIFEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPA
• Gene Sequence: HASQDELAASAYQAVEVDRQFDGAAVQVRVRMGTEPRHFMAIFKGKLVIFEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPA
• Gene ID - Mouse: ENSMUSG00000025432
• Gene ID - Rat: ENSRNOG00000050419
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AVIL pAb (ATL-HPA058864) – 2 Found

Hunter, Diana V; Smaila, Brittney D; Lopes, Douglas M; Takatoh, Jun; Denk, Franziska; Ramer, Matt S. Advillin Is Expressed in All Adult Neural Crest-Derived Neurons. Eneuro. 2018;5(5) 

Esmaeilniakooshkghazi, Amin; George, Sudeep P; Biswas, Ritwika; Khurana, Seema. Mouse intestinal tuft cells express advillin but not villin. Scientific Reports. 2020;10(1):8877.