Anti AVIL pAb (ATL-HPA058864)
Atlas Antibodies
- SKU:
- ATL-HPA058864-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: AVIL
Alternative Gene Name: ADVIL, DOC6, FLJ12386, p92
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025432: 90%, ENSRNOG00000050419: 91%
Entrez Gene ID: 10677
Uniprot ID: O75366
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HASQDELAASAYQAVEVDRQFDGAAVQVRVRMGTEPRHFMAIFKGKLVIFEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPA |
| Gene Sequence | HASQDELAASAYQAVEVDRQFDGAAVQVRVRMGTEPRHFMAIFKGKLVIFEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPA |
| Gene ID - Mouse | ENSMUSG00000025432 |
| Gene ID - Rat | ENSRNOG00000050419 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AVIL pAb (ATL-HPA058864) | |
| Datasheet | Anti AVIL pAb (ATL-HPA058864) Datasheet (External Link) |
| Vendor Page | Anti AVIL pAb (ATL-HPA058864) at Atlas Antibodies |
| Documents & Links for Anti AVIL pAb (ATL-HPA058864) | |
| Datasheet | Anti AVIL pAb (ATL-HPA058864) Datasheet (External Link) |
| Vendor Page | Anti AVIL pAb (ATL-HPA058864) |
| Citations for Anti AVIL pAb (ATL-HPA058864) – 2 Found |
| Hunter, Diana V; Smaila, Brittney D; Lopes, Douglas M; Takatoh, Jun; Denk, Franziska; Ramer, Matt S. Advillin Is Expressed in All Adult Neural Crest-Derived Neurons. Eneuro. 2018;5(5) PubMed |
| Esmaeilniakooshkghazi, Amin; George, Sudeep P; Biswas, Ritwika; Khurana, Seema. Mouse intestinal tuft cells express advillin but not villin. Scientific Reports. 2020;10(1):8877. PubMed |