Anti AVEN pAb (ATL-HPA020863)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020863-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: AVEN
Alternative Gene Name: PDCD12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003604: 62%, ENSRNOG00000006419: 63%
Entrez Gene ID: 57099
Uniprot ID: Q9NQS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSK |
Gene Sequence | GPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSK |
Gene ID - Mouse | ENSMUSG00000003604 |
Gene ID - Rat | ENSRNOG00000006419 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AVEN pAb (ATL-HPA020863) | |
Datasheet | Anti AVEN pAb (ATL-HPA020863) Datasheet (External Link) |
Vendor Page | Anti AVEN pAb (ATL-HPA020863) at Atlas Antibodies |
Documents & Links for Anti AVEN pAb (ATL-HPA020863) | |
Datasheet | Anti AVEN pAb (ATL-HPA020863) Datasheet (External Link) |
Vendor Page | Anti AVEN pAb (ATL-HPA020863) |
Citations for Anti AVEN pAb (ATL-HPA020863) – 1 Found |
Muther, Charlotte; Jobeili, Lara; Garion, Maëlle; Heraud, Sandrine; Thepot, Amélie; Damour, Odile; Lamartine, Jérôme. An expression screen for aged-dependent microRNAs identifies miR-30a as a key regulator of aging features in human epidermis. Aging. 2017;9(11):2376-2396. PubMed |