Anti AVEN pAb (ATL-HPA020863)

Atlas Antibodies

SKU: ATL-HPA020863-25

• 
• 

Protein Description: apoptosis, caspase activation inhibitor
Gene Name: AVEN
Alternative Gene Name: PDCD12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003604: 62%, ENSRNOG00000006419: 63%
Entrez Gene ID: 57099
Uniprot ID: Q9NQS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSK
• Gene Sequence: GPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSK
• Gene ID - Mouse: ENSMUSG00000003604
• Gene ID - Rat: ENSRNOG00000006419
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AVEN pAb (ATL-HPA020863) – 1 Found

Muther, Charlotte; Jobeili, Lara; Garion, Maëlle; Heraud, Sandrine; Thepot, Amélie; Damour, Odile; Lamartine, Jérôme. An expression screen for aged-dependent microRNAs identifies miR-30a as a key regulator of aging features in human epidermis. Aging. 2017;9(11):2376-2396.