Anti AUTS2 pAb (ATL-HPA000390)

Atlas Antibodies

Catalog No.:
ATL-HPA000390-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: autism susceptibility candidate 2
Gene Name: AUTS2
Alternative Gene Name: FBRSL2, KIAA0442
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110939: 90%, ENSRNOG00000000885: 91%
Entrez Gene ID: 26053
Uniprot ID: Q8WXX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen NSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADR
Gene Sequence NSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADR
Gene ID - Mouse ENSMUSG00000110939
Gene ID - Rat ENSRNOG00000000885
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AUTS2 pAb (ATL-HPA000390)
Datasheet Anti AUTS2 pAb (ATL-HPA000390) Datasheet (External Link)
Vendor Page Anti AUTS2 pAb (ATL-HPA000390) at Atlas Antibodies

Documents & Links for Anti AUTS2 pAb (ATL-HPA000390)
Datasheet Anti AUTS2 pAb (ATL-HPA000390) Datasheet (External Link)
Vendor Page Anti AUTS2 pAb (ATL-HPA000390)
Citations for Anti AUTS2 pAb (ATL-HPA000390) – 10 Found
Inoue, Yukiko U; Inoue, Takayoshi. Brain enhancer activities at the gene-poor 5p14.1 autism-associated locus. Scientific Reports. 2016;6( 27503586):31227.  PubMed
Parras, Alberto; Anta, Héctor; Santos-Galindo, María; Swarup, Vivek; Elorza, Ainara; Nieto-González, José L; Picó, Sara; Hernández, Ivó H; Díaz-Hernández, Juan I; Belloc, Eulàlia; Rodolosse, Annie; Parikshak, Neelroop N; Peñagarikano, Olga; Fernández-Chacón, Rafael; Irimia, Manuel; Navarro, Pilar; Geschwind, Daniel H; Méndez, Raúl; Lucas, José J. Autism-like phenotype and risk gene mRNA deadenylation by CPEB4 mis-splicing. Nature. 2018;560(7719):441-446.  PubMed
Castanza, Anthony S; Ramirez, Sanja; Tripathi, Prem P; Daza, Ray A M; Kalume, Franck K; Ramirez, Jan-Marino; Hevner, Robert F. AUTS2 Regulates RNA Metabolism and Dentate Gyrus Development in Mice. Cerebral Cortex (New York, N.y. : 1991). 2021;31(10):4808-4824.  PubMed
Li, Jun; Sun, Xiaoxuan; You, Yang; Li, Qiongwei; Wei, Chengwen; Zhao, Linnan; Sun, Mengwen; Meng, Hu; Zhang, Tian; Yue, Weihua; Wang, Lifang; Zhang, Dai. Auts2 deletion involves in DG hypoplasia and social recognition deficit: The developmental and neural circuit mechanisms. Science Advances. 2022;8(9):eabk1238.  PubMed
Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81.  PubMed
Bedogni, Francesco; Hodge, Rebecca D; Nelson, Branden R; Frederick, Erika A; Shiba, Naoko; Daza, Ray A; Hevner, Robert F. Autism susceptibility candidate 2 (Auts2) encodes a nuclear protein expressed in developing brain regions implicated in autism neuropathology. Gene Expression Patterns : Gep. 2010;10(1):9-15.  PubMed
Lancaster, Madeline A; Renner, Magdalena; Martin, Carol-Anne; Wenzel, Daniel; Bicknell, Louise S; Hurles, Matthew E; Homfray, Tessa; Penninger, Josef M; Jackson, Andrew P; Knoblich, Juergen A. Cerebral organoids model human brain development and microcephaly. Nature. 2013;501(7467):373-9.  PubMed
Oksenberg, N; Haliburton, G D E; Eckalbar, W L; Oren, I; Nishizaki, S; Murphy, K; Pollard, K S; Birnbaum, R Y; Ahituv, N. Genome-wide distribution of Auts2 binding localizes with active neurodevelopmental genes. Translational Psychiatry. 2014;4(9):e431.  PubMed
Weisner, P Anne; Chen, Chih-Ying; Sun, Younguk; Yoo, Jennifer; Kao, Wei-Chun; Zhang, Huimin; Baltz, Emily T; Troy, Joseph M; Stubbs, Lisa. A Mouse Mutation That Dysregulates Neighboring Galnt17 and Auts2 Genes Is Associated with Phenotypes Related to the Human AUTS2 Syndrome. G3 (Bethesda, Md.). 2019;9(11):3891-3906.  PubMed
Fair, Summer R; Schwind, Wesley; Julian, Dominic L; Biel, Alecia; Guo, Gongbo; Rutherford, Ryan; Ramadesikan, Swetha; Westfall, Jesse; Miller, Katherine E; Kararoudi, Meisam Naeimi; Hickey, Scott E; Mosher, Theresa Mihalic; McBride, Kim L; Neinast, Reid; Fitch, James; Lee, Dean A; White, Peter; Wilson, Richard K; Bedrosian, Tracy A; Koboldt, Daniel C; Hester, Mark E. Cerebral organoids containing an AUTS2 missense variant model microcephaly. Brain : A Journal Of Neurology. 2023;146(1):387-404.  PubMed