Anti AURKC pAb (ATL-HPA034859)
Atlas Antibodies
- SKU:
- ATL-HPA034859-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AURKC
Alternative Gene Name: ARK3, AurC, STK13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040174: 42%, ENSRNOG00000021003: 34%
Entrez Gene ID: 6795
Uniprot ID: Q9UQB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDF |
Gene Sequence | AVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDF |
Gene ID - Mouse | ENSMUSG00000040174 |
Gene ID - Rat | ENSRNOG00000021003 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AURKC pAb (ATL-HPA034859) | |
Datasheet | Anti AURKC pAb (ATL-HPA034859) Datasheet (External Link) |
Vendor Page | Anti AURKC pAb (ATL-HPA034859) at Atlas Antibodies |
Documents & Links for Anti AURKC pAb (ATL-HPA034859) | |
Datasheet | Anti AURKC pAb (ATL-HPA034859) Datasheet (External Link) |
Vendor Page | Anti AURKC pAb (ATL-HPA034859) |