Anti AURKC pAb (ATL-HPA034859)

Atlas Antibodies

Catalog No.: ATL-HPA034859-25

Protein Description: aurora kinase C
Gene Name: AURKC
Alternative Gene Name: ARK3, AurC, STK13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040174: 42%, ENSRNOG00000021003: 34%
Entrez Gene ID: 6795
Uniprot ID: Q9UQB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDF
• Gene Sequence: AVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDF
• Gene ID - Mouse: ENSMUSG00000040174
• Gene ID - Rat: ENSRNOG00000021003
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.