Anti AURKC pAb (ATL-HPA034859)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034859-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: AURKC
Alternative Gene Name: ARK3, AurC, STK13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040174: 42%, ENSRNOG00000021003: 34%
Entrez Gene ID: 6795
Uniprot ID: Q9UQB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDF |
| Gene Sequence | AVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDF |
| Gene ID - Mouse | ENSMUSG00000040174 |
| Gene ID - Rat | ENSRNOG00000021003 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AURKC pAb (ATL-HPA034859) | |
| Datasheet | Anti AURKC pAb (ATL-HPA034859) Datasheet (External Link) |
| Vendor Page | Anti AURKC pAb (ATL-HPA034859) at Atlas Antibodies |
| Documents & Links for Anti AURKC pAb (ATL-HPA034859) | |
| Datasheet | Anti AURKC pAb (ATL-HPA034859) Datasheet (External Link) |
| Vendor Page | Anti AURKC pAb (ATL-HPA034859) |