Anti AURKC pAb (ATL-HPA034859)

Atlas Antibodies

Catalog No.:
ATL-HPA034859-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: aurora kinase C
Gene Name: AURKC
Alternative Gene Name: ARK3, AurC, STK13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040174: 42%, ENSRNOG00000021003: 34%
Entrez Gene ID: 6795
Uniprot ID: Q9UQB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDF
Gene Sequence AVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDF
Gene ID - Mouse ENSMUSG00000040174
Gene ID - Rat ENSRNOG00000021003
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AURKC pAb (ATL-HPA034859)
Datasheet Anti AURKC pAb (ATL-HPA034859) Datasheet (External Link)
Vendor Page Anti AURKC pAb (ATL-HPA034859) at Atlas Antibodies

Documents & Links for Anti AURKC pAb (ATL-HPA034859)
Datasheet Anti AURKC pAb (ATL-HPA034859) Datasheet (External Link)
Vendor Page Anti AURKC pAb (ATL-HPA034859)