Anti AURKB pAb (ATL-HPA037708)

Atlas Antibodies

Catalog No.:
ATL-HPA037708-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: aurora kinase B
Gene Name: AURKB
Alternative Gene Name: Aik2, AIM-1, ARK2, AurB, IPL1, PPP1R48, STK12, STK5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020897: 55%, ENSRNOG00000005659: 53%
Entrez Gene ID: 9212
Uniprot ID: Q96GD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID
Gene Sequence WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID
Gene ID - Mouse ENSMUSG00000020897
Gene ID - Rat ENSRNOG00000005659
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AURKB pAb (ATL-HPA037708)
Datasheet Anti AURKB pAb (ATL-HPA037708) Datasheet (External Link)
Vendor Page Anti AURKB pAb (ATL-HPA037708) at Atlas Antibodies

Documents & Links for Anti AURKB pAb (ATL-HPA037708)
Datasheet Anti AURKB pAb (ATL-HPA037708) Datasheet (External Link)
Vendor Page Anti AURKB pAb (ATL-HPA037708)