Anti AURKB pAb (ATL-HPA037708)

Atlas Antibodies

SKU: ATL-HPA037708-25

• 

Protein Description: aurora kinase B
Gene Name: AURKB
Alternative Gene Name: Aik2, AIM-1, ARK2, AurB, IPL1, PPP1R48, STK12, STK5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020897: 55%, ENSRNOG00000005659: 53%
Entrez Gene ID: 9212
Uniprot ID: Q96GD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID
• Gene Sequence: WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID
• Gene ID - Mouse: ENSMUSG00000020897
• Gene ID - Rat: ENSRNOG00000005659
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.