Anti AURKB pAb (ATL-HPA037708)
Atlas Antibodies
- SKU:
- ATL-HPA037708-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: AURKB
Alternative Gene Name: Aik2, AIM-1, ARK2, AurB, IPL1, PPP1R48, STK12, STK5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020897: 55%, ENSRNOG00000005659: 53%
Entrez Gene ID: 9212
Uniprot ID: Q96GD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID |
Gene Sequence | WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID |
Gene ID - Mouse | ENSMUSG00000020897 |
Gene ID - Rat | ENSRNOG00000005659 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AURKB pAb (ATL-HPA037708) | |
Datasheet | Anti AURKB pAb (ATL-HPA037708) Datasheet (External Link) |
Vendor Page | Anti AURKB pAb (ATL-HPA037708) at Atlas Antibodies |
Documents & Links for Anti AURKB pAb (ATL-HPA037708) | |
Datasheet | Anti AURKB pAb (ATL-HPA037708) Datasheet (External Link) |
Vendor Page | Anti AURKB pAb (ATL-HPA037708) |