Anti AURKAIP1 pAb (ATL-HPA031821)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031821-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AURKAIP1
Alternative Gene Name: AIP, AKIP, FLJ20608
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000065990: 89%, ENSRNOG00000018691: 87%
Entrez Gene ID: 54998
Uniprot ID: Q9NWT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLR |
Gene Sequence | KMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLR |
Gene ID - Mouse | ENSMUSG00000065990 |
Gene ID - Rat | ENSRNOG00000018691 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AURKAIP1 pAb (ATL-HPA031821) | |
Datasheet | Anti AURKAIP1 pAb (ATL-HPA031821) Datasheet (External Link) |
Vendor Page | Anti AURKAIP1 pAb (ATL-HPA031821) at Atlas Antibodies |
Documents & Links for Anti AURKAIP1 pAb (ATL-HPA031821) | |
Datasheet | Anti AURKAIP1 pAb (ATL-HPA031821) Datasheet (External Link) |
Vendor Page | Anti AURKAIP1 pAb (ATL-HPA031821) |