Anti AURKAIP1 pAb (ATL-HPA031821)

Atlas Antibodies

Catalog No.:
ATL-HPA031821-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: aurora kinase A interacting protein 1
Gene Name: AURKAIP1
Alternative Gene Name: AIP, AKIP, FLJ20608
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000065990: 89%, ENSRNOG00000018691: 87%
Entrez Gene ID: 54998
Uniprot ID: Q9NWT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLR
Gene Sequence KMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLR
Gene ID - Mouse ENSMUSG00000065990
Gene ID - Rat ENSRNOG00000018691
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AURKAIP1 pAb (ATL-HPA031821)
Datasheet Anti AURKAIP1 pAb (ATL-HPA031821) Datasheet (External Link)
Vendor Page Anti AURKAIP1 pAb (ATL-HPA031821) at Atlas Antibodies

Documents & Links for Anti AURKAIP1 pAb (ATL-HPA031821)
Datasheet Anti AURKAIP1 pAb (ATL-HPA031821) Datasheet (External Link)
Vendor Page Anti AURKAIP1 pAb (ATL-HPA031821)