Anti AURKA pAb (ATL-HPA002636)

Atlas Antibodies

Catalog No.: ATL-HPA002636-25

Protein Description: aurora kinase A
Gene Name: AURKA
Alternative Gene Name: AIK, ARK1, AurA, BTAK, PPP1R47, STK15, STK6, STK7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027496: 66%, ENSRNOG00000004479: 67%
Entrez Gene ID: 6790
Uniprot ID: O14965
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVYL
• Gene Sequence: ISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVYL
• Gene ID - Mouse: ENSMUSG00000027496
• Gene ID - Rat: ENSRNOG00000004479
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AURKA pAb (ATL-HPA002636) – 8 Found

Koh, Hyun Min; Jang, Bo Geun; Hyun, Chang Lim; Kim, Young Sill; Hyun, Jin Won; Chang, Weon Young; Maeng, Young Hee. Aurora Kinase A Is a Prognostic Marker in Colorectal Adenocarcinoma. Journal Of Pathology And Translational Medicine. 2017;51(1):32-39. 

Zhan, Shi-Jie; Liu, Bin; Linghu, Hua. Identifying genes as potential prognostic indicators in patients with serous ovarian cancer resistant to carboplatin using integrated bioinformatics analysis. Oncology Reports. 2018;39(6):2653-2663. 

Shah, Khyati N; Bhatt, Roma; Rotow, Julia; Rohrberg, Julia; Olivas, Victor; Wang, Victoria E; Hemmati, Golzar; Martins, Maria M; Maynard, Ashley; Kuhn, Jonathan; Galeas, Jacqueline; Donnella, Hayley J; Kaushik, Swati; Ku, Angel; Dumont, Sophie; Krings, Gregor; Haringsma, Henry J; Robillard, Liliane; Simmons, Andrew D; Harding, Thomas C; McCormick, Frank; Goga, Andrei; Blakely, Collin M; Bivona, Trever G; Bandyopadhyay, Sourav. Aurora kinase A drives the evolution of resistance to third-generation EGFR inhibitors in lung cancer. Nature Medicine. 2019;25(1):111-118. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Ma, Xi; Zhou, Lin; Zheng, Shusen. Transcriptome analysis revealed key prognostic genes and microRNAs in hepatocellular carcinoma. Peerj. 8( 32296612):e8930. 

Løkkegaard, Sanne; Elias, Daniel; Alves, Carla L; Bennetzen, Martin V; Lænkholm, Anne-Vibeke; Bak, Martin; Gjerstorff, Morten F; Johansen, Lene E; Vever, Henriette; Bjerre, Christina; Kirkegaard, Tove; Nordenskjöld, Bo; Fornander, Tommy; Stål, Olle; Lindström, Linda S; Esserman, Laura J; Lykkesfeldt, Anne E; Andersen, Jens S; Leth-Larsen, Rikke; Ditzel, Henrik J. MCM3 upregulation confers endocrine resistance in breast cancer and is a predictive marker of diminished tamoxifen benefit. Npj Breast Cancer. 2021;7(1):2. 

Chen, Huaping; Wu, Junrong; Lu, Liuyi; Hu, Zuojian; Li, Xi; Huang, Li; Zhang, Xiaolian; Chen, Mingxing; Qin, Xue; Xie, Li. Identification of Hub Genes Associated With Immune Infiltration and Predict Prognosis in Hepatocellular Carcinoma via Bioinformatics Approaches. Frontiers In Genetics. 11( 33505422):575762. 

Skov, Natascha; Alves, Carla L; Ehmsen, Sidse; Ditzel, Henrik J. Aurora Kinase A and Bcl-xL Inhibition Suppresses Metastasis in Triple-Negative Breast Cancer. International Journal Of Molecular Sciences. 2022;23(17)