Anti AUP1 pAb (ATL-HPA007674)

Atlas Antibodies

SKU: ATL-HPA007674-25

• 
• 

Protein Description: ancient ubiquitous protein 1
Gene Name: AUP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068328: 86%, ENSRNOG00000007842: 88%
Entrez Gene ID: 550
Uniprot ID: Q9Y679
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPT
• Gene Sequence: LLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPT
• Gene ID - Mouse: ENSMUSG00000068328
• Gene ID - Rat: ENSRNOG00000007842
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AUP1 pAb (ATL-HPA007674) – 5 Found

Schulz, Jasmin; Avci, Dönem; Queisser, Markus A; Gutschmidt, Aljona; Dreher, Lena-Sophie; Fenech, Emma J; Volkmar, Norbert; Hayashi, Yuki; Hoppe, Thorsten; Christianson, John C. Conserved cytoplasmic domains promote Hrd1 ubiquitin ligase complex formation for ER-associated degradation (ERAD). Journal Of Cell Science. 2017;130(19):3322-3335. 

Stefanovic-Barrett, Sandra; Dickson, Anna S; Burr, Stephen P; Williamson, James C; Lobb, Ian T; van den Boomen, Dick Jh; Lehner, Paul J; Nathan, James A. MARCH6 and TRC8 facilitate the quality control of cytosolic and tail-anchored proteins. Embo Reports. 2018;19(5) 

Hartman, Isamu Z; Liu, Pingsheng; Zehmer, John K; Luby-Phelps, Katherine; Jo, Youngah; Anderson, Richard G W; DeBose-Boyd, Russell A. Sterol-induced dislocation of 3-hydroxy-3-methylglutaryl coenzyme A reductase from endoplasmic reticulum membranes into the cytosol through a subcellular compartment resembling lipid droplets. The Journal Of Biological Chemistry. 2010;285(25):19288-98. 

Sugihara, Munechika; Morito, Daisuke; Ainuki, Shiori; Hirano, Yoshinobu; Ogino, Kazutoyo; Kitamura, Akira; Hirata, Hiromi; Nagata, Kazuhiro. The AAA+ ATPase/ubiquitin ligase mysterin stabilizes cytoplasmic lipid droplets. The Journal Of Cell Biology. 2019;218(3):949-960. 

Fenech, Emma J; Lari, Federica; Charles, Philip D; Fischer, Roman; Laétitia-Thézénas, Marie; Bagola, Katrin; Paton, Adrienne W; Paton, James C; Gyrd-Hansen, Mads; Kessler, Benedikt M; Christianson, John C. Interaction mapping of endoplasmic reticulum ubiquitin ligases identifies modulators of innate immune signalling. Elife. 2020;9( 32614325)