Anti AUNIP pAb (ATL-HPA028730 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA028730-25
  • Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and AUNIP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411413).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aurora kinase A and ninein interacting protein
Gene Name: AUNIP
Alternative Gene Name: AIBp, C1orf135, MGC2603
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078521: 66%, ENSRNOG00000022030: 67%
Entrez Gene ID: 79000
Uniprot ID: Q9H7T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CGVWLDAAALKRRKVQTHLIKPGTKMLTLLPGERKANIYFTQRRAPSTGIHQRSIASFFTLQPGKTNGSDQTSVSSHTESQIN
Gene Sequence CGVWLDAAALKRRKVQTHLIKPGTKMLTLLPGERKANIYFTQRRAPSTGIHQRSIASFFTLQPGKTNGSDQTSVSSHTESQIN
Gene ID - Mouse ENSMUSG00000078521
Gene ID - Rat ENSRNOG00000022030
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AUNIP pAb (ATL-HPA028730 w/enhanced validation)
Datasheet Anti AUNIP pAb (ATL-HPA028730 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AUNIP pAb (ATL-HPA028730 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AUNIP pAb (ATL-HPA028730 w/enhanced validation)
Datasheet Anti AUNIP pAb (ATL-HPA028730 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AUNIP pAb (ATL-HPA028730 w/enhanced validation)