Anti AUH pAb (ATL-HPA004171 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA004171-25

• 

Protein Description: AU RNA binding protein/enoyl-CoA hydratase
Gene Name: AUH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021460: 70%, ENSRNOG00000011684: 67%
Entrez Gene ID: 549
Uniprot ID: Q13825
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SAWLCPGLRLPGSLAGRRAGPAIWAQGWVPAAGGPAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKK
• Gene Sequence: SAWLCPGLRLPGSLAGRRAGPAIWAQGWVPAAGGPAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKK
• Gene ID - Mouse: ENSMUSG00000021460
• Gene ID - Rat: ENSRNOG00000011684
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.