Anti AUH pAb (ATL-HPA004171 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA004171-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: AU RNA binding protein/enoyl-CoA hydratase
Gene Name: AUH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021460: 70%, ENSRNOG00000011684: 67%
Entrez Gene ID: 549
Uniprot ID: Q13825
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAWLCPGLRLPGSLAGRRAGPAIWAQGWVPAAGGPAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKK
Gene Sequence SAWLCPGLRLPGSLAGRRAGPAIWAQGWVPAAGGPAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKK
Gene ID - Mouse ENSMUSG00000021460
Gene ID - Rat ENSRNOG00000011684
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AUH pAb (ATL-HPA004171 w/enhanced validation)
Datasheet Anti AUH pAb (ATL-HPA004171 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AUH pAb (ATL-HPA004171 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AUH pAb (ATL-HPA004171 w/enhanced validation)
Datasheet Anti AUH pAb (ATL-HPA004171 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AUH pAb (ATL-HPA004171 w/enhanced validation)