Anti ATXN7L3B pAb (ATL-HPA056612)

Atlas Antibodies

Catalog No.:
ATL-HPA056612-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ataxin 7-like 3B
Gene Name: ATXN7L3B
Alternative Gene Name: lnc-SCA7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074748: 89%, ENSRNOG00000059744: 93%
Entrez Gene ID: 552889
Uniprot ID: Q96GX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKCGYFYLEFAETGSVKDFGIQPVEDKGACRLPLCSLPGEPGNGPDQQLQRSPPEFQ
Gene Sequence VKCGYFYLEFAETGSVKDFGIQPVEDKGACRLPLCSLPGEPGNGPDQQLQRSPPEFQ
Gene ID - Mouse ENSMUSG00000074748
Gene ID - Rat ENSRNOG00000059744
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATXN7L3B pAb (ATL-HPA056612)
Datasheet Anti ATXN7L3B pAb (ATL-HPA056612) Datasheet (External Link)
Vendor Page Anti ATXN7L3B pAb (ATL-HPA056612) at Atlas Antibodies

Documents & Links for Anti ATXN7L3B pAb (ATL-HPA056612)
Datasheet Anti ATXN7L3B pAb (ATL-HPA056612) Datasheet (External Link)
Vendor Page Anti ATXN7L3B pAb (ATL-HPA056612)