Anti ATXN3 pAb (ATL-HPA069338)

Atlas Antibodies

Catalog No.:
ATL-HPA069338-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: ataxin 3
Gene Name: ATXN3
Alternative Gene Name: ATX3, JOS, MJD, SCA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021189: 78%, ENSRNOG00000005470: 84%
Entrez Gene ID: 4287
Uniprot ID: P54252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFE
Gene Sequence SRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFE
Gene ID - Mouse ENSMUSG00000021189
Gene ID - Rat ENSRNOG00000005470
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATXN3 pAb (ATL-HPA069338)
Datasheet Anti ATXN3 pAb (ATL-HPA069338) Datasheet (External Link)
Vendor Page Anti ATXN3 pAb (ATL-HPA069338) at Atlas Antibodies

Documents & Links for Anti ATXN3 pAb (ATL-HPA069338)
Datasheet Anti ATXN3 pAb (ATL-HPA069338) Datasheet (External Link)
Vendor Page Anti ATXN3 pAb (ATL-HPA069338)