Anti ATXN3 pAb (ATL-HPA069338)

Atlas Antibodies

Catalog No.: ATL-HPA069338-25

Protein Description: ataxin 3
Gene Name: ATXN3
Alternative Gene Name: ATX3, JOS, MJD, SCA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021189: 78%, ENSRNOG00000005470: 84%
Entrez Gene ID: 4287
Uniprot ID: P54252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFE
• Gene Sequence: SRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFE
• Gene ID - Mouse: ENSMUSG00000021189
• Gene ID - Rat: ENSRNOG00000005470
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.