Anti ATXN2L pAb (ATL-HPA043391)

Atlas Antibodies

Catalog No.:
ATL-HPA043391-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ataxin 2-like
Gene Name: ATXN2L
Alternative Gene Name: A2D, A2lp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032637: 84%, ENSRNOG00000018686: 82%
Entrez Gene ID: 11273
Uniprot ID: Q8WWM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKEEPKGKEKEVDGLLTSEPMGSPVSSKTESVSDKEDKPPLAPSGGTEGPEQPPPPCPSQTGSPPVGLIKGED
Gene Sequence LKEEPKGKEKEVDGLLTSEPMGSPVSSKTESVSDKEDKPPLAPSGGTEGPEQPPPPCPSQTGSPPVGLIKGED
Gene ID - Mouse ENSMUSG00000032637
Gene ID - Rat ENSRNOG00000018686
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATXN2L pAb (ATL-HPA043391)
Datasheet Anti ATXN2L pAb (ATL-HPA043391) Datasheet (External Link)
Vendor Page Anti ATXN2L pAb (ATL-HPA043391) at Atlas Antibodies

Documents & Links for Anti ATXN2L pAb (ATL-HPA043391)
Datasheet Anti ATXN2L pAb (ATL-HPA043391) Datasheet (External Link)
Vendor Page Anti ATXN2L pAb (ATL-HPA043391)
Citations for Anti ATXN2L pAb (ATL-HPA043391) – 1 Found
Key, Jana; Harter, Patrick N; Sen, Nesli-Ece; Gradhand, Elise; Auburger, Georg; Gispert, Suzana. Mid-Gestation lethality of Atxn2l-Ablated Mice. International Journal Of Molecular Sciences. 2020;21(14)  PubMed