Anti ATXN2 pAb (ATL-HPA021146 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA021146-25

• 
• 

Protein Description: ataxin 2
Gene Name: ATXN2
Alternative Gene Name: ATX2, SCA2, TNRC13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042605: 90%, ENSRNOG00000001256: 91%
Entrez Gene ID: 6311
Uniprot ID: Q99700
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNET
• Gene Sequence: RHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNET
• Gene ID - Mouse: ENSMUSG00000042605
• Gene ID - Rat: ENSRNOG00000001256
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATXN2 pAb (ATL-HPA021146 w/enhanced validation) – 2 Found

Brown, Alexander S; Meera, Pratap; Altindag, Banu; Chopra, Ravi; Perkins, Emma M; Paul, Sharan; Scoles, Daniel R; Tarapore, Eric; Magri, Jessica; Huang, Haoran; Jackson, Mandy; Shakkottai, Vikram G; Otis, Thomas S; Pulst, Stefan M; Atwood, Scott X; Oro, Anthony E. MTSS1/Src family kinase dysregulation underlies multiple inherited ataxias. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2018;115(52):E12407-E12416. 

Abraham, Karan J; Chan, Janet N Y; Salvi, Jayesh S; Ho, Brandon; Hall, Amanda; Vidya, Elva; Guo, Ru; Killackey, Samuel A; Liu, Nancy; Lee, Jeffrey E; Brown, Grant W; Mekhail, Karim. Intersection of calorie restriction and magnesium in the suppression of genome-destabilizing RNA-DNA hybrids. Nucleic Acids Research. 2016;44(18):8870-8884.