Anti ATXN1L pAb (ATL-HPA062789)

Atlas Antibodies

Catalog No.:
ATL-HPA062789-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ataxin 1-like
Gene Name: ATXN1L
Alternative Gene Name: BOAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069895: 96%, ENSRNOG00000038766: 93%
Entrez Gene ID: 342371
Uniprot ID: P0C7T5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HPGIHYPPLHYAQLPSTSLQFIGSPYSLPYAVPPNFLPSPLLSPSANLATSHLPHFVPYASLLAEGATPP
Gene Sequence HPGIHYPPLHYAQLPSTSLQFIGSPYSLPYAVPPNFLPSPLLSPSANLATSHLPHFVPYASLLAEGATPP
Gene ID - Mouse ENSMUSG00000069895
Gene ID - Rat ENSRNOG00000038766
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATXN1L pAb (ATL-HPA062789)
Datasheet Anti ATXN1L pAb (ATL-HPA062789) Datasheet (External Link)
Vendor Page Anti ATXN1L pAb (ATL-HPA062789) at Atlas Antibodies

Documents & Links for Anti ATXN1L pAb (ATL-HPA062789)
Datasheet Anti ATXN1L pAb (ATL-HPA062789) Datasheet (External Link)
Vendor Page Anti ATXN1L pAb (ATL-HPA062789)