Anti ATRX pAb (ATL-HPA064684)

Atlas Antibodies

Catalog No.: ATL-HPA064684-25

Protein Description: alpha thalassemia/mental retardation syndrome X-linked
Gene Name: ATRX
Alternative Gene Name: JMS, MRX52, RAD54, XH2, XNP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031229: 51%, ENSRNOG00000056703: 57%
Entrez Gene ID: 546
Uniprot ID: P46100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSE
• Gene Sequence: EFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSE
• Gene ID - Mouse: ENSMUSG00000031229
• Gene ID - Rat: ENSRNOG00000056703
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATRX pAb (ATL-HPA064684) – 1 Found

de Nonneville, Alexandre; Salas, Sébastien; Bertucci, François; Sobinoff, Alexander P; Adélaïde, José; Guille, Arnaud; Finetti, Pascal; Noble, Jane R; Churikov, Dimitri; Chaffanet, Max; Lavit, Elise; Pickett, Hilda A; Bouvier, Corinne; Birnbaum, Daniel; Reddel, Roger R; Géli, Vincent. TOP3A amplification and ATRX inactivation are mutually exclusive events in pediatric osteosarcomas using ALT. Embo Molecular Medicine. 2022;14(10):e15859.