Anti ATRX pAb (ATL-HPA001906 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001906-25

• 
• 
• 

Protein Description: alpha thalassemia/mental retardation syndrome X-linked
Gene Name: ATRX
Alternative Gene Name: JMS, RAD54, XH2, XNP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031229: 96%, ENSRNOG00000056703: 97%
Entrez Gene ID: 546
Uniprot ID: P46100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR
• Gene Sequence: AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR
• Gene ID - Mouse: ENSMUSG00000031229
• Gene ID - Rat: ENSRNOG00000056703
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATRX pAb (ATL-HPA001906 w/enhanced validation) – 106 Found

Reis, Gerald F; Pekmezci, Melike; Hansen, Helen M; Rice, Terri; Marshall, Roxanne E; Molinaro, Annette M; Phillips, Joanna J; Vogel, Hannes; Wiencke, John K; Wrensch, Margaret R; Walsh, Kyle M; Perry, Arie. CDKN2A loss is associated with shortened overall survival in lower-grade (World Health Organization Grades II-III) astrocytomas. Journal Of Neuropathology And Experimental Neurology. 2015;74(5):442-52. 

Oh, Ji Eun; Ohta, Takashi; Nonoguchi, Naosuke; Satomi, Kaishi; Capper, David; Pierscianek, Daniela; Sure, Ulrich; Vital, Anne; Paulus, Werner; Mittelbronn, Michel; Antonelli, Manila; Kleihues, Paul; Giangaspero, Felice; Ohgaki, Hiroko. Genetic Alterations in Gliosarcoma and Giant Cell Glioblastoma. Brain Pathology (Zurich, Switzerland). 2016;26(4):517-22. 

Solomon, David A; Wood, Matthew D; Tihan, Tarik; Bollen, Andrew W; Gupta, Nalin; Phillips, Joanna J J; Perry, Arie. Diffuse Midline Gliomas with Histone H3-K27M Mutation: A Series of 47 Cases Assessing the Spectrum of Morphologic Variation and Associated Genetic Alterations. Brain Pathology (Zurich, Switzerland). 2016;26(5):569-80. 

Kim, Michelle M; Camelo-Piragua, Sandra; Schipper, Matthew; Tao, Yebin; Normolle, Daniel; Junck, Larry; Mammoser, Aaron; Betz, Bryan L; Cao, Yue; Kim, Christopher J; Heth, Jason; Sagher, Oren; Lawrence, Theodore S; Tsien, Christina I. Gemcitabine Plus Radiation Therapy for High-Grade Glioma: Long-Term Results of a Phase 1 Dose-Escalation Study. International Journal Of Radiation Oncology, Biology, Physics. 2016;94(2):305-11. 

Mäkinen, Netta; Aavikko, Mervi; Heikkinen, Tuomas; Taipale, Minna; Taipale, Jussi; Koivisto-Korander, Riitta; Bützow, Ralf; Vahteristo, Pia. Exome Sequencing of Uterine Leiomyosarcomas Identifies Frequent Mutations in TP53, ATRX, and MED12. Plos Genetics. 2016;12(2):e1005850. 

Zacher, Angela; Kaulich, Kerstin; Stepanow, Stefanie; Wolter, Marietta; Köhrer, Karl; Felsberg, Jörg; Malzkorn, Bastian; Reifenberger, Guido. Molecular Diagnostics of Gliomas Using Next Generation Sequencing of a Glioma-Tailored Gene Panel. Brain Pathology (Zurich, Switzerland). 2017;27(2):146-159. 

Valle-García, David; Qadeer, Zulekha A; McHugh, Domhnall S; Ghiraldini, Flávia G; Chowdhury, Asif H; Hasson, Dan; Dyer, Michael A; Recillas-Targa, Félix; Bernstein, Emily. ATRX binds to atypical chromatin domains at the 3' exons of zinc finger genes to preserve H3K9me3 enrichment. Epigenetics. 2016;11(6):398-414. 

Oktay, Yavuz; Ülgen, Ege; Can, Özge; Akyerli, Cemaliye B; Yüksel, Şirin; Erdemgil, Yiğit; Durası, I Melis; Henegariu, Octavian Ioan; Nanni, E Paolo; Selevsek, Nathalie; Grossmann, Jonas; Erson-Omay, E Zeynep; Bai, Hanwen; Gupta, Manu; Lee, William; Turcan, Şevin; Özpınar, Aysel; Huse, Jason T; Sav, M Aydın; Flanagan, Adrienne; Günel, Murat; Sezerman, O Uğur; Yakıcıer, M Cengiz; Pamir, M Necmettin; Özduman, Koray. IDH-mutant glioma specific association of rs55705857 located at 8q24.21 involves MYC deregulation. Scientific Reports. 2016;6( 27282637):27569. 

Singhi, Aatur D; Liu, Ta-Chiang; Roncaioli, Justin L; Cao, Dengfeng; Zeh, Herbert J; Zureikat, Amer H; Tsung, Allan; Marsh, J Wallis; Lee, Kenneth K; Hogg, Melissa E; Bahary, Nathan; Brand, Randall E; McGrath, Kevin M; Slivka, Adam; Cressman, Kristi L; Fuhrer, Kimberly; O'Sullivan, Roderick J. Alternative Lengthening of Telomeres and Loss of DAXX/ATRX Expression Predicts Metastatic Disease and Poor Survival in Patients with Pancreatic Neuroendocrine Tumors. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2017;23(2):600-609. 

Vinagre, João; Nabais, Joana; Pinheiro, Jorge; Batista, Rui; Oliveira, Rui Caetano; Gonçalves, António Pedro; Pestana, Ana; Reis, Marta; Mesquita, Bárbara; Pinto, Vasco; Lyra, Joana; Cipriano, Maria Augusta; Ferreira, Miguel Godinho; Lopes, José Manuel; Sobrinho-Simões, Manuel; Soares, Paula. TERT promoter mutations in pancreatic endocrine tumours are rare and mainly found in tumours from patients with hereditary syndromes. Scientific Reports. 2016;6( 27411289):29714. 

Slatter, Tania L; Hsia, Howard; Samaranayaka, Ari; Sykes, Peter; Clow, William Bill; Devenish, Celia J; Sutton, Tim; Royds, Janice A; Ip, Philip P; Cheung, Annie N; Hung, Noelyn Anne. Loss of ATRX and DAXX expression identifies poor prognosis for smooth muscle tumours of uncertain malignant potential and early stage uterine leiomyosarcoma. The Journal Of Pathology. Clinical Research. 2015;1(2):95-105. 

Deeg, Katharina I; Chung, Inn; Bauer, Caroline; Rippe, Karsten. Cancer Cells with Alternative Lengthening of Telomeres Do Not Display a General Hypersensitivity to ATR Inhibition. Frontiers In Oncology. 6( 27602331):186. 

Ronellenfitsch, Michael W; Oh, Ji-Eun; Satomi, Kaishi; Sumi, Koichiro; Harter, Patrick N; Steinbach, Joachim P; Felsberg, Jörg; Capper, David; Voegele, Catherine; Durand, Geoffroy; McKay, James; Le Calvez-Kelm, Florence; Schittenhelm, Jens; Klink, Barbara; Mittelbronn, Michel; Ohgaki, Hiroko. CASP9 germline mutation in a family with multiple brain tumors. Brain Pathology (Zurich, Switzerland). 2018;28(1):94-102. 

Broniscer, Alberto; Hwang, Scott N; Chamdine, Omar; Lin, Tong; Pounds, Stanley; Onar-Thomas, Arzu; Chi, Lei; Shurtleff, Sheila; Allen, Sariah; Gajjar, Amar; Northcott, Paul; Orr, Brent A. Bithalamic gliomas may be molecularly distinct from their unilateral high-grade counterparts. Brain Pathology (Zurich, Switzerland). 2018;28(1):112-120. 

Pekmezci, Melike; Rice, Terri; Molinaro, Annette M; Walsh, Kyle M; Decker, Paul A; Hansen, Helen; Sicotte, Hugues; Kollmeyer, Thomas M; McCoy, Lucie S; Sarkar, Gobinda; Perry, Arie; Giannini, Caterina; Tihan, Tarik; Berger, Mitchel S; Wiemels, Joseph L; Bracci, Paige M; Eckel-Passow, Jeanette E; Lachance, Daniel H; Clarke, Jennifer; Taylor, Jennie W; Luks, Tracy; Wiencke, John K; Jenkins, Robert B; Wrensch, Margaret R. Adult infiltrating gliomas with WHO 2016 integrated diagnosis: additional prognostic roles of ATRX and TERT. Acta Neuropathologica. 2017;133(6):1001-1016. 

Kiviniemi, Aida; Gardberg, Maria; Kivinen, Katri; Posti, Jussi P; Vuorinen, Ville; Sipilä, Jussi; Rahi, Melissa; Sankinen, Matti; Minn, Heikki. Somatostatin receptor 2A in gliomas: Association with oligodendrogliomas and favourable outcome. Oncotarget. 2017;8(30):49123-49132. 

Cleven, Arjen H G; Suijker, Johnny; Agrogiannis, Georgios; Briaire-de Bruijn, Inge H; Frizzell, Norma; Hoekstra, Attje S; Wijers-Koster, Pauline M; Cleton-Jansen, Anne-Marie; Bovée, Judith V M G. IDH1 or -2 mutations do not predict outcome and do not cause loss of 5-hydroxymethylcytosine or altered histone modifications in central chondrosarcomas. Clinical Sarcoma Research. 7( 28484589):8. 

Park, Joo Kyung; Paik, Woo Hyun; Lee, Kyoungbun; Ryu, Ji Kon; Lee, Sang Hyub; Kim, Yong-Tae. DAXX/ATRX and MEN1 genes are strong prognostic markers in pancreatic neuroendocrine tumors. Oncotarget. 2017;8(30):49796-49806. 

Murnyák, Balázs; Kouhsari, Mahan C; Hershkovitch, Rotem; Kálmán, Bernadette; Marko-Varga, György; Klekner, Álmos; Hortobágyi, Tibor. PARP1 expression and its correlation with survival is tumour molecular subtype dependent in glioblastoma. Oncotarget. 2017;8(28):46348-46362. 

Rosager, Ann Mari; Sørensen, Mia D; Dahlrot, Rikke H; Boldt, Henning B; Hansen, Steinbjørn; Lathia, Justin D; Kristensen, Bjarne W. Expression and prognostic value of JAM-A in gliomas. Journal Of Neuro-Oncology. 2017;135(1):107-117. 

Pratt, Drew; Pittaluga, Stefania; Palisoc, Maryknoll; Fetsch, Patricia; Xi, Liqiang; Raffeld, Mark; Gilbert, Mark R; Quezado, Martha. Expression of CD70 (CD27L) Is Associated With Epithelioid and Sarcomatous Features in IDH-Wild-Type Glioblastoma. Journal Of Neuropathology And Experimental Neurology. 2017;76(8):697-708. 

Lee, Yujin; Koh, Jaemoon; Kim, Seong-Ik; Won, Jae Kyung; Park, Chul-Kee; Choi, Seung Hong; Park, Sung-Hye. The frequency and prognostic effect of TERT promoter mutation in diffuse gliomas. Acta Neuropathologica Communications. 2017;5(1):62. 

Hayes, Josie; Yu, Yao; Jalbert, Llewellyn E; Mazor, Tali; Jones, Lindsey E; Wood, Matthew D; Walsh, Kyle M; Bengtsson, Henrik; Hong, Chibo; Oberndorfer, Stefan; Roetzer, Thomas; Smirnov, Ivan V; Clarke, Jennifer L; Aghi, Manish K; Chang, Susan M; Nelson, Sarah J; Woehrer, Adelheid; Phillips, Joanna J; Solomon, David A; Costello, Joseph F. Genomic analysis of the origins and evolution of multicentric diffuse lower-grade gliomas. Neuro-Oncology. 2018;20(5):632-641. 

Valentini, Maria Consuelo; Mellai, Marta; Annovazzi, Laura; Melcarne, Antonio; Denysenko, Tetyana; Cassoni, Paola; Casalone, Cristina; Maurella, Cristiana; Grifoni, Silvia; Fania, Piercarlo; Cistaro, Angelina; Schiffer, Davide. Comparison among conventional and advanced MRI, (18)F-FDG PET/CT, phenotype and genotype in glioblastoma. Oncotarget. 2017;8(53):91636-91653. 

Ballester, Leomar Y; Boghani, Zain; Baskin, David S; Britz, Gavin W; Olsen, Randall; Fuller, Gregory N; Powell, Suzanne Z; Cykowski, Matthew D. Creutzfeldt astrocytes may be seen in IDH-wildtype glioblastoma and retain expression of DNA repair and chromatin binding proteins. Brain Pathology (Zurich, Switzerland). 2018;28(6):1012-1019. 

Bell, W Robert; Meeker, Alan K; Rizzo, Anthony; Rajpara, Sumit; Rosenthal, Ian M; Flores Bellver, Miguel; Aparicio Domingo, Silvia; Zhong, Xiufeng; Barber, John R; Joshu, Corinne E; Canto-Soler, M Valeria; Eberhart, Charles G; Heaphy, Christopher M. A unique telomere DNA expansion phenotype in human retinal rod photoreceptors associated with aging and disease. Brain Pathology (Zurich, Switzerland). 2019;29(1):45-52. 

Masui, Kenta; Komori, Takashi; Kato, Yukinari; Masutomi, Kenkichi; Ichimura, Koichi; Ogasawara, Satoshi; Kaneko, Mika K; Oki, Hiroharu; Suzuki, Hiroyoshi; Nitta, Masayuki; Maruyama, Takashi; Muragaki, Yoshihiro; Kawamata, Takakazu; Sawada, Tatsuo; Shibata, Noriyuki. Elevated TERT Expression in TERT-Wildtype Adult Diffuse Gliomas: Histological Evaluation with a Novel TERT-Specific Antibody. Biomed Research International. 2018( 29693015):7945845. 

Li, Ningning; Zhang, Ying; Sidlauskas, Kastytis; Ellis, Matthew; Evans, Ian; Frankel, Paul; Lau, Joanne; El-Hassan, Tedani; Guglielmi, Loredana; Broni, Jessica; Richard-Loendt, Angela; Brandner, Sebastian. Inhibition of GPR158 by microRNA-449a suppresses neural lineage of glioma stem/progenitor cells and correlates with higher glioma grades. Oncogene. 2018;37(31):4313-4333. 

Lu, Hsiang-Chih; Eulo, Vanessa; Apicelli, Anthony J; Pekmezci, Melike; Tao, Yu; Luo, Jingqin; Hirbe, Angela C; Dahiya, Sonika. Aberrant ATRX protein expression is associated with poor overall survival in NF1-MPNST. Oncotarget. 2018;9(33):23018-23028. 

Diplas, Bill H; He, Xujun; Brosnan-Cashman, Jacqueline A; Liu, Heng; Chen, Lee H; Wang, Zhaohui; Moure, Casey J; Killela, Patrick J; Loriaux, Daniel B; Lipp, Eric S; Greer, Paula K; Yang, Rui; Rizzo, Anthony J; Rodriguez, Fausto J; Friedman, Allan H; Friedman, Henry S; Wang, Sizhen; He, Yiping; McLendon, Roger E; Bigner, Darell D; Jiao, Yuchen; Waitkus, Matthew S; Meeker, Alan K; Yan, Hai. The genomic landscape of TERT promoter wildtype-IDH wildtype glioblastoma. Nature Communications. 2018;9(1):2087. 

Brosnan-Cashman, Jacqueline A; Yuan, Ming; Graham, Mindy K; Rizzo, Anthony J; Myers, Kaylar M; Davis, Christine; Zhang, Rebecca; Esopi, David M; Raabe, Eric H; Eberhart, Charles G; Heaphy, Christopher M; Meeker, Alan K. ATRX loss induces multiple hallmarks of the alternative lengthening of telomeres (ALT) phenotype in human glioma cell lines in a cell line-specific manner. Plos One. 13(9):e0204159. 

Kafka, Anja; Karin-Kujundžić, Valentina; Šerman, Ljiljana; Bukovac, Anja; Njirić, Niko; Jakovčević, Antonia; Pećina-Šlaus, Nives. Hypermethylation of Secreted Frizzled Related Protein 1 gene promoter in different astrocytoma grades. Croatian Medical Journal. 2018;59(5):213-223. 

Liverani, Chiara; Bongiovanni, Alberto; Mercatali, Laura; Foca, Flavia; Pieri, Federica; De Vita, Alessandro; Spadazzi, Chiara; Miserocchi, Giacomo; Recine, Federica; Riva, Nada; Nicolini, Silvia; Severi, Stefano; Martinelli, Giovanni; Ibrahim, Toni. Grading of Neuroendocrine Carcinomas: Correlation of (68)Ga-PET/CT Scan with Tissue Biomarkers. Disease Markers. 2018( 30627226):6878409. 

Liu, Jiayu; Zhang, Xuebin; Yan, Xiaoling; Sun, Mei; Fan, Yueshan; Huang, Ying. Significance of TERT and ATRX mutations in glioma. Oncology Letters. 2019;17(1):95-102. 

Han, Mingqi; Napier, Christine E; Frölich, Sonja; Teber, Erdahl; Wong, Ted; Noble, Jane R; Choi, Eugene H Y; Everett, Roger D; Cesare, Anthony J; Reddel, Roger R. Synthetic lethality of cytolytic HSV-1 in cancer cells with ATRX and PML deficiency. Journal Of Cell Science. 2019;132(5) 

Steele, Christopher D; Tarabichi, Maxime; Oukrif, Dahmane; Webster, Amy P; Ye, Hongtao; Fittall, Matthew; Lombard, Patrick; Martincorena, Iñigo; Tarpey, Patrick S; Collord, Grace; Haase, Kerstin; Strauss, Sandra J; Berisha, Fitim; Vaikkinen, Heli; Dhami, Pawan; Jansen, Marnix; Behjati, Sam; Amary, M Fernanda; Tirabosco, Roberto; Feber, Andrew; Campbell, Peter J; Alexandrov, Ludmil B; Van Loo, Peter; Flanagan, Adrienne M; Pillay, Nischalan. Undifferentiated Sarcomas Develop through Distinct Evolutionary Pathways. Cancer Cell. 2019;35(3):441-456.e8. 

Fereidouni, Farzad; Harmany, Zachary T; Tian, Miao; Todd, Austin; Kintner, John A; McPherson, John D; Borowsky, Alexander D; Bishop, John; Lechpammer, Mirna; Demos, Stavros G; Levenson, Richard. Microscopy with ultraviolet surface excitation for rapid slide-free histology. Nature Biomedical Engineering. 2017;1(12):957-966. 

Chen, Jie; Schmidt, Robert E; Dahiya, Sonika. Pituitary Adenoma in Pediatric and Adolescent Populations. Journal Of Neuropathology And Experimental Neurology. 2019;78(7):626-632. 

Cardona, Andrés Felipe; Rojas, Leonardo; Wills, Beatriz; Behaine, José; Jiménez, Enrique; Hakim, Fernando; Useche, Nicolás; Bermúdez, Sonia; Arrieta, Oscar; Mejía, Juan Armando; Ramón, Juan Fernando; Carranza, Hernán; Vargas, Carlos; Otero, Jorge; González, Diego; Rodríguez, July; Ortiz, León Darío; Cifuentes, Hernando; Balaña, Carmen. Genotyping low-grade gliomas among Hispanics. Neuro-Oncology Practice. 2016;3(3):164-172. 

Kwon, Mi Jung; Kang, So Young; Cho, Haeyon; Lee, Jung Il; Kim, Sung Tae; Suh, Yeon-Lim. Clinical relevance of molecular subgrouping of gliomatosis cerebri per 2016 WHO classification: a clinicopathological study of 89 cases. Brain Pathology (Zurich, Switzerland). 2020;30(2):235-245. 

Rodriguez, Fausto J; Graham, Mindy K; Brosnan-Cashman, Jacqueline A; Barber, John R; Davis, Christine; Vizcaino, M Adelita; Palsgrove, Doreen N; Giannini, Caterina; Pekmezci, Melike; Dahiya, Sonika; Gokden, Murat; Noë, Michael; Wood, Laura D; Pratilas, Christine A; Morris, Carol D; Belzberg, Allan; Blakeley, Jaishri; Heaphy, Christopher M. Telomere alterations in neurofibromatosis type 1-associated solid tumors. Acta Neuropathologica Communications. 2019;7(1):139. 

Yang, Rui Ryan; Shi, Zhi-Feng; Zhang, Zhen-Yu; Chan, Aden Ka-Yin; Aibaidula, Abudumijiti; Wang, Wei-Wei; Kwan, Johnny Sheung Him; Poon, Wai Sang; Chen, Hong; Li, Wen-Cai; Chung, Nellie Yuk-Fei; Punchhi, Gopika; Chu, William Ching-Yuen; Chan, Ivan Sik-Hei; Liu, Xian-Zhi; Mao, Ying; Li, Kay Ka-Wai; Ng, Ho-Keung. IDH mutant lower grade (WHO Grades II/III) astrocytomas can be stratified for risk by CDKN2A, CDK4 and PDGFRA copy number alterations. Brain Pathology (Zurich, Switzerland). 2020;30(3):541-553. 

Viaene, Angela N; Pu, Cunfeng; Perry, Arie; Li, Marilyn M; Luo, Minjie; Santi, Mariarita. Congenital tumors of the central nervous system: an institutional review of 64 cases with emphasis on tumors with unique histologic and molecular characteristics. Brain Pathology (Zurich, Switzerland). 2021;31(1):45-60. 

He, Chen; Xu, Ke; Zhu, Xiaoyan; Dunphy, Paige S; Gudenas, Brian; Lin, Wenwei; Twarog, Nathaniel; Hover, Laura D; Kwon, Chang-Hyuk; Kasper, Lawryn H; Zhang, Junyuan; Li, Xiaoyu; Dalton, James; Jonchere, Barbara; Mercer, Kimberly S; Currier, Duane G; Caufield, William; Wang, Yingzhe; Xie, Jia; Broniscer, Alberto; Wetmore, Cynthia; Upadhyaya, Santhosh A; Qaddoumi, Ibrahim; Klimo, Paul; Boop, Frederick; Gajjar, Amar; Zhang, Jinghui; Orr, Brent A; Robinson, Giles W; Monje, Michelle; Freeman Iii, Burgess B; Roussel, Martine F; Northcott, Paul A; Chen, Taosheng; Rankovic, Zoran; Wu, Gang; Chiang, Jason; Tinkle, Christopher L; Shelat, Anang A; Baker, Suzanne J. Patient-derived models recapitulate heterogeneity of molecular signatures and drug response in pediatric high-grade glioma. Nature Communications. 2021;12(1):4089. 

Anand, Nidhi; Husain, Nuzhat; Varshney, Renu; Malhotra, Kiran Preet; Kaif, Mohammad. Molecular classification and stratification of adult diffuse gliomas: A tertiary care center study. Journal Of Carcinogenesis. 20( 34729052):20. 

Kim, Hyunhee; Lim, Ka Young; Park, Jin Woo; Kang, Jeongwan; Won, Jae Kyung; Lee, Kwanghoon; Shim, Yumi; Park, Chul-Kee; Kim, Seung-Ki; Choi, Seung-Hong; Kim, Tae Min; Yun, Hongseok; Park, Sung-Hye. Sporadic and Lynch syndrome-associated mismatch repair-deficient brain tumors. Laboratory Investigation; A Journal Of Technical Methods And Pathology. 2022;102(2):160-171. 

Stojanoski, Stefan; Boldt, Henning Bünsow; Kozic, Dusko; Patócs, Attila; Korbonits, Márta; Medic-Stojanoska, Milica; Casar-Borota, Olivera. Case Report: Malignant Primary Sellar Paraganglioma With Unusual Genetic and Imaging Features. Frontiers In Oncology. 11( 34888235):739255. 

Dahuja, Gitanshu; Gupta, Ashok; Jindal, Arpita; Jain, Gaurav; Sharma, Santosh; Kumar, Arvind. Clinicopathological Correlation of Glioma Patients with respect to Immunohistochemistry Markers: A Prospective Study of 115 Patients in a Tertiary Care Hospital in North India. Asian Journal Of Neurosurgery. 2021;16(4):732-737. 

Sumislawski, Piotr; Rotermund, Roman; Klose, Silke; Lautenbach, Anne; Wefers, Annika K; Soltwedel, Celina; Mohammadi, Behnam; Jacobsen, Frank; Mawrin, Christian; Flitsch, Jörg; Saeger, Wolfgang. ACTH-secreting pituitary carcinoma with TP53, NF1, ATRX and PTEN mutations Case report and review of the literature. Endocrine. 2022;76(1):228-236. 

Frank, Lukas; Rademacher, Anne; Mücke, Norbert; Tirier, Stephan M; Koeleman, Emma; Knotz, Caroline; Schumacher, Sabrina; Stainczyk, Sabine A; Westermann, Frank; Fröhling, Stefan; Chudasama, Priya; Rippe, Karsten. ALT-FISH quantifies alternative lengthening of telomeres activity by imaging of single-stranded repeats. Nucleic Acids Research. 2022;50(11):e61. 

Yanai, Hirotsugu; Ishida, Mitsuaki; Yoshikawa, Katsuhiro; Tsuta, Koji; Sekimoto, Mitsugu; Sugie, Tomoharu. Immunohistochemical analyses of the expression profiles of INSM1, ATRX, DAXX and DLL3 in solid papillary carcinomas of the breast. Oncology Letters. 2022;23(4):137. 

Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. 

Heaphy, Christopher M; de Wilde, Roeland F; Jiao, Yuchen; Klein, Alison P; Edil, Barish H; Shi, Chanjuan; Bettegowda, Chetan; Rodriguez, Fausto J; Eberhart, Charles G; Hebbar, Sachidanand; Offerhaus, G Johan; McLendon, Roger; Rasheed, B Ahmed; He, Yiping; Yan, Hai; Bigner, Darell D; Oba-Shinjo, Sueli Mieko; Marie, Suely Kazue Nagahashi; Riggins, Gregory J; Kinzler, Kenneth W; Vogelstein, Bert; Hruban, Ralph H; Maitra, Anirban; Papadopoulos, Nickolas; Meeker, Alan K. Altered telomeres in tumors with ATRX and DAXX mutations. Science (New York, N.y.). 2011;333(6041):425. 

Schwartzentruber, Jeremy; Korshunov, Andrey; Liu, Xiao-Yang; Jones, David T W; Pfaff, Elke; Jacob, Karine; Sturm, Dominik; Fontebasso, Adam M; Quang, Dong-Anh Khuong; Tönjes, Martje; Hovestadt, Volker; Albrecht, Steffen; Kool, Marcel; Nantel, Andre; Konermann, Carolin; Lindroth, Anders; Jäger, Natalie; Rausch, Tobias; Ryzhova, Marina; Korbel, Jan O; Hielscher, Thomas; Hauser, Peter; Garami, Miklos; Klekner, Almos; Bognar, Laszlo; Ebinger, Martin; Schuhmann, Martin U; Scheurlen, Wolfram; Pekrun, Arnulf; Frühwald, Michael C; Roggendorf, Wolfgang; Kramm, Christoph; Dürken, Matthias; Atkinson, Jeffrey; Lepage, Pierre; Montpetit, Alexandre; Zakrzewska, Magdalena; Zakrzewski, Krzystof; Liberski, Pawel P; Dong, Zhifeng; Siegel, Peter; Kulozik, Andreas E; Zapatka, Marc; Guha, Abhijit; Malkin, David; Felsberg, Jörg; Reifenberger, Guido; von Deimling, Andreas; Ichimura, Koichi; Collins, V Peter; Witt, Hendrik; Milde, Till; Witt, Olaf; Zhang, Cindy; Castelo-Branco, Pedro; Lichter, Peter; Faury, Damien; Tabori, Uri; Plass, Christoph; Majewski, Jacek; Pfister, Stefan M; Jabado, Nada. Driver mutations in histone H3.3 and chromatin remodelling genes in paediatric glioblastoma. Nature. 2012;482(7384):226-31. 

de Wilde, Roeland F; Heaphy, Christopher M; Maitra, Anirban; Meeker, Alan K; Edil, Barish H; Wolfgang, Christopher L; Ellison, Trevor A; Schulick, Richard D; Molenaar, I Quintus; Valk, Gerlof D; Vriens, Menno R; Borel Rinkes, Inne H M; Offerhaus, G Johan A; Hruban, Ralph H; Matsukuma, Karen E. Loss of ATRX or DAXX expression and concomitant acquisition of the alternative lengthening of telomeres phenotype are late events in a small subset of MEN-1 syndrome pancreatic neuroendocrine tumors. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2012;25(7):1033-9. 

Lovejoy, Courtney A; Li, Wendi; Reisenweber, Steven; Thongthip, Supawat; Bruno, Joanne; de Lange, Titia; De, Saurav; Petrini, John H J; Sung, Patricia A; Jasin, Maria; Rosenbluh, Joseph; Zwang, Yaara; Weir, Barbara A; Hatton, Charlie; Ivanova, Elena; Macconaill, Laura; Hanna, Megan; Hahn, William C; Lue, Neal F; Reddel, Roger R; Jiao, Yuchen; Kinzler, Kenneth; Vogelstein, Bert; Papadopoulos, Nickolas; Meeker, Alan K. Loss of ATRX, genome instability, and an altered DNA damage response are hallmarks of the alternative lengthening of telomeres pathway. Plos Genetics. 8(7):e1002772. 

Jiao, Yuchen; Killela, Patrick J; Reitman, Zachary J; Rasheed, Ahmed B; Heaphy, Christopher M; de Wilde, Roeland F; Rodriguez, Fausto J; Rosemberg, Sergio; Oba-Shinjo, Sueli Mieko; Nagahashi Marie, Suely Kazue; Bettegowda, Chetan; Agrawal, Nishant; Lipp, Eric; Pirozzi, Christopher; Lopez, Giselle; He, Yiping; Friedman, Henry; Friedman, Allan H; Riggins, Gregory J; Holdhoff, Matthias; Burger, Peter; McLendon, Roger; Bigner, Darell D; Vogelstein, Bert; Meeker, Alan K; Kinzler, Kenneth W; Papadopoulos, Nickolas; Diaz, Luis A; Yan, Hai. Frequent ATRX, CIC, FUBP1 and IDH1 mutations refine the classification of malignant gliomas. Oncotarget. 2012;3(7):709-22. 

Nguyen, Doreen N; Heaphy, Christopher M; de Wilde, Roeland F; Orr, Brent A; Odia, Yazmin; Eberhart, Charles G; Meeker, Alan K; Rodriguez, Fausto J. Molecular and morphologic correlates of the alternative lengthening of telomeres phenotype in high-grade astrocytomas. Brain Pathology (Zurich, Switzerland). 2013;23(3):237-43. 

Abedalthagafi, Malak; Phillips, Joanna J; Kim, Grace E; Mueller, Sabine; Haas-Kogen, Daphne A; Marshall, Roxanne E; Croul, Sidney E; Santi, Mariarita R; Cheng, Jing; Zhou, Shengmei; Sullivan, Lisa M; Martinez-Lage, Maria; Judkins, Alexander R; Perry, Arie. The alternative lengthening of telomere phenotype is significantly associated with loss of ATRX expression in high-grade pediatric and adult astrocytomas: a multi-institutional study of 214 astrocytomas. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2013;26(11):1425-32. 

Cairncross, J Gregory; Wang, Meihua; Jenkins, Robert B; Shaw, Edward G; Giannini, Caterina; Brachman, David G; Buckner, Jan C; Fink, Karen L; Souhami, Luis; Laperriere, Normand J; Huse, Jason T; Mehta, Minesh P; Curran, Walter J Jr. Benefit from procarbazine, lomustine, and vincristine in oligodendroglial tumors is associated with mutation of IDH. Journal Of Clinical Oncology : Official Journal Of The American Society Of Clinical Oncology. 2014;32(8):783-90. 

Haberler, Christine; Wöhrer, Adelheid. Clinical Neuropathology practice news 2-2014: ATRX, a new candidate biomarker in gliomas. Clinical Neuropathology. 2014;33(2):108-11. 

Barszczyk, Mark; Buczkowicz, Pawel; Castelo-Branco, Pedro; Mack, Stephen C; Ramaswamy, Vijay; Mangerel, Joshua; Agnihotri, Sameer; Remke, Marc; Golbourn, Brian; Pajovic, Sanja; Elizabeth, Cynthia; Yu, Man; Luu, Betty; Morrison, Andrew; Adamski, Jennifer; Nethery-Brokx, Kathleen; Li, Xiao-Nan; Van Meter, Timothy; Dirks, Peter B; Rutka, James T; Taylor, Michael D; Tabori, Uri; Hawkins, Cynthia. Telomerase inhibition abolishes the tumorigenicity of pediatric ependymoma tumor-initiating cells. Acta Neuropathologica. 2014;128(6):863-77. 

Cryan, Jane B; Haidar, Sam; Ramkissoon, Lori A; Bi, Wenya Linda; Knoff, David S; Schultz, Nikolaus; Abedalthagafi, Malak; Brown, Loreal; Wen, Patrick Y; Reardon, David A; Dunn, Ian F; Folkerth, Rebecca D; Santagata, Sandro; Lindeman, Neal I; Ligon, Azra H; Beroukhim, Rameen; Hornick, Jason L; Alexander, Brian M; Ligon, Keith L; Ramkissoon, Shakti H. Clinical multiplexed exome sequencing distinguishes adult oligodendroglial neoplasms from astrocytic and mixed lineage gliomas. Oncotarget. 2014;5(18):8083-92. 

Fishbein, Lauren; Khare, Sanika; Wubbenhorst, Bradley; DeSloover, Daniel; D'Andrea, Kurt; Merrill, Shana; Cho, Nam Woo; Greenberg, Roger A; Else, Tobias; Montone, Kathleen; LiVolsi, Virginia; Fraker, Douglas; Daber, Robert; Cohen, Debbie L; Nathanson, Katherine L. Whole-exome sequencing identifies somatic ATRX mutations in pheochromocytomas and paragangliomas. Nature Communications. 2015;6( 25608029):6140. 

Hayashi, Saeko; Sasaki, Hikaru; Kimura, Tokuhiro; Abe, Takayuki; Nakamura, Takumi; Kitamura, Yohei; Miwa, Tomoru; Kameyama, Kaori; Hirose, Yuichi; Yoshida, Kazunari. Molecular-genetic and clinical characteristics of gliomas with astrocytic appearance and total 1p19q loss in a single institutional consecutive cohort. Oncotarget. 2015;6(18):15871-81. 

Napier, Christine E; Huschtscha, Lily I; Harvey, Adam; Bower, Kylie; Noble, Jane R; Hendrickson, Eric A; Reddel, Roger R. ATRX represses alternative lengthening of telomeres. Oncotarget. 2015;6(18):16543-58. 

Li, Yan-Xi; Shi, Zhifeng; Aibaidula, Abudumijiti; Chen, Hong; Tang, Qisheng; Li, Kay Ka-Wai; Chung, Nellie Yuk-Fei; Chan, Danny Tat-Ming; Poon, Wai Sang; Mao, Ying; Wu, Jinsong; Zhou, Liangfu; Chan, Aden Ka-Yin; Ng, Ho-Keung. Not all 1p/19q non-codeleted oligodendroglial tumors are astrocytic. Oncotarget. 2016;7(40):64615-64630. 

Kim, Joo Young; Brosnan-Cashman, Jacqueline A; An, Soyeon; Kim, Sung Joo; Song, Ki-Byung; Kim, Min-Sun; Kim, Mi-Ju; Hwang, Dae Wook; Meeker, Alan K; Yu, Eunsil; Kim, Song Cheol; Hruban, Ralph H; Heaphy, Christopher M; Hong, Seung-Mo. Alternative Lengthening of Telomeres in Primary Pancreatic Neuroendocrine Tumors Is Associated with Aggressive Clinical Behavior and Poor Survival. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2017;23(6):1598-1606. 

VandenBussche, Christopher J; Allison, Derek B; Graham, Mindy K; Charu, Vivek; Lennon, Anne Marie; Wolfgang, Christopher L; Hruban, Ralph H; Heaphy, Christopher M. Alternative lengthening of telomeres and ATRX/DAXX loss can be reliably detected in FNAs of pancreatic neuroendocrine tumors. Cancer Cytopathology. 2017;125(7):544-551. 

Mohamed, Amira; Romano, David; Saveanu, Alexandru; Roche, Catherine; Albertelli, Manuela; Barbieri, Federica; Brue, Thierry; Niccoli, Patricia; Delpero, Jean-Robert; Garcia, Stephane; Ferone, Diego; Florio, Tullio; Moutardier, Vincent; Poizat, Flora; Barlier, Anne; Gerard, Corinne. Anti-proliferative and anti-secretory effects of everolimus on human pancreatic neuroendocrine tumors primary cultures: is there any benefit from combination with somatostatin analogs?. Oncotarget. 2017;8(25):41044-41063. 

Uekawa, Ken; Nakamura, Hideo; Shinojima, Naoki; Takezaki, Tatsuya; Yano, Shigetoshi; Kuratsu, Jun-Ichi. Adult Diffuse Astrocytoma in the Medulla Oblongata: Molecular Biological Analyses Including H3F3A Mutation of Histone H3.3. Nmc Case Report Journal. 2016;3(2):29-33. 

Kim, Seong-Ik; Lee, Yujin; Won, Jae-Kyung; Park, Chul-Kee; Choi, Seung Hong; Park, Sung-Hye. Reclassification of Mixed Oligoastrocytic Tumors Using a Genetically Integrated Diagnostic Approach. Journal Of Pathology And Translational Medicine. 2018;52(1):28-36. 

Li, Xia; Wei, Jie; Liu, Yixiong; Li, Peifeng; Fan, Linni; Wang, Yingmei; Li, Mingyang; Zhao, Danhui; Yu, Zhou; Ye, Jing; Guo, Ying; Yan, Qingguo; Guo, Shuangping; Wang, Zhe. Primary Astrocytic Tumours and Paired Recurrences have Similar Biological Features in IDH1, TP53 and TERTp Mutation and MGMT, ATRX Loss. Scientific Reports. 2017;7(1):13038. 

Byron, Sara A; Tran, Nhan L; Halperin, Rebecca F; Phillips, Joanna J; Kuhn, John G; de Groot, John F; Colman, Howard; Ligon, Keith L; Wen, Patrick Y; Cloughesy, Timothy F; Mellinghoff, Ingo K; Butowski, Nicholas A; Taylor, Jennie W; Clarke, Jennifer L; Chang, Susan M; Berger, Mitchel S; Molinaro, Annette M; Maggiora, Gerald M; Peng, Sen; Nasser, Sara; Liang, Winnie S; Trent, Jeffrey M; Berens, Michael E; Carpten, John D; Craig, David W; Prados, Michael D. Prospective Feasibility Trial for Genomics-Informed Treatment in Recurrent and Progressive Glioblastoma. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2018;24(2):295-305. 

Bieńkowski, Michał; Wöhrer, Adelheid; Moser, Patrizia; Kitzwögerer, Melitta; Ricken, Gerda; Ströbel, Thomas; Hainfellner, Johannes A. Molecular diagnostic testing of diffuse gliomas in the real-life setting: A practical approach. Clinical Neuropathology. 2018;37(4):166-177. 

Palsgrove, Doreen N; Brosnan-Cashman, Jacqueline A; Giannini, Caterina; Raghunathan, Aditya; Jentoft, Mark; Bettegowda, Chetan; Gokden, Murat; Lin, Doris; Yuan, Ming; Lin, Ming-Tseh; Heaphy, Christopher M; Rodriguez, Fausto J. Subependymal giant cell astrocytoma-like astrocytoma: a neoplasm with a distinct phenotype and frequent neurofibromatosis type-1-association. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2018;31(12):1787-1800. 

Rodriguez, Fausto J; Brosnan-Cashman, Jacqueline A; Allen, Sariah J; Vizcaino, M Adelita; Giannini, Caterina; Camelo-Piragua, Sandra; Webb, Milad; Matsushita, Marcus; Wadhwani, Nitin; Tabbarah, Abeer; Hamideh, Dima; Jiang, Liqun; Chen, Liam; Arvanitis, Leonidas D; Alnajar, Hussein H; Barber, John R; Rodríguez-Velasco, Alicia; Orr, Brent; Heaphy, Christopher M. Alternative lengthening of telomeres, ATRX loss and H3-K27M mutations in histologically defined pilocytic astrocytoma with anaplasia. Brain Pathology (Zurich, Switzerland). 2019;29(1):126-140. 

Vizcaino, M Adelita; Palsgrove, Doreen N; Yuan, Ming; Giannini, Caterina; Cabrera-Aldana, Eibar Ernesto; Pallavajjala, Aparna; Burger, Peter C; Rodriguez, Fausto J. Granular cell astrocytoma: an aggressive IDH-wildtype diffuse glioma with molecular genetic features of primary glioblastoma. Brain Pathology (Zurich, Switzerland). 2019;29(2):193-204. 

D'Angelo, Fulvio; Ceccarelli, Michele; Tala; Garofano, Luciano; Zhang, Jing; Frattini, Véronique; Caruso, Francesca P; Lewis, Genevieve; Alfaro, Kristin D; Bauchet, Luc; Berzero, Giulia; Cachia, David; Cangiano, Mario; Capelle, Laurent; de Groot, John; DiMeco, Francesco; Ducray, François; Farah, Walid; Finocchiaro, Gaetano; Goutagny, Stéphane; Kamiya-Matsuoka, Carlos; Lavarino, Cinzia; Loiseau, Hugues; Lorgis, Véronique; Marras, Carlo E; McCutcheon, Ian; Nam, Do-Hyun; Ronchi, Susanna; Saletti, Veronica; Seizeur, Romuald; Slopis, John; Suñol, Mariona; Vandenbos, Fanny; Varlet, Pascale; Vidaud, Dominique; Watts, Colin; Tabar, Viviane; Reuss, David E; Kim, Seung-Ki; Meyronet, David; Mokhtari, Karima; Salvador, Hector; Bhat, Krishna P; Eoli, Marica; Sanson, Marc; Lasorella, Anna; Iavarone, Antonio. The molecular landscape of glioma in patients with Neurofibromatosis 1. Nature Medicine. 2019;25(1):176-187. 

Berthier, Sylvie; Larrouquère, Louis; Champelovier, Pierre; Col, Edwige; Lefebvre, Christine; Cottet-Rouselle, Cécile; Arnaud, Josiane; Garrel, Catherine; Laporte, François; Boutonnat, Jean; Faure, Patrice; Hazane-Puch, Florence. A New Patient-Derived Metastatic Glioblastoma Cell Line: Characterisation and Response to Sodium Selenite Anticancer Agent. Cancers. 2018;11(1) 

Yost, Kathryn E; Clatterbuck Soper, Sarah F; Walker, Robert L; Pineda, Marbin A; Zhu, Yuelin J; Ester, Corbin D; Showman, Soyeon; Roschke, Anna V; Waterfall, Joshua J; Meltzer, Paul S. Rapid and reversible suppression of ALT by DAXX in osteosarcoma cells. Scientific Reports. 2019;9(1):4544. 

Martínez, Haydee; Nagurney, Michelle; Wang, Zi-Xuan; Eberhart, Charles G; Heaphy, Christopher M; Curtis, Mark T; Rodriguez, Fausto J. ATRX Mutations in Pineal Parenchymal Tumors of Intermediate Differentiation. Journal Of Neuropathology And Experimental Neurology. 2019;78(8):703-708. 

Kim, Jo-Heon; Jang, Woo-Youl; Jung, Tae-Young; Jung, Shin; Kim, Kyung-Keun; Kim, Hyung-Seok; Kim, Eun-Hee; Lee, Min-Cheol; Moon, Kyung-Sub; Lee, Kyung-Hwa. Recurrent Glioma With Lineage Conversion From Oligodendroglioma to Astrocytoma in Two Cases. Frontiers In Oncology. 9( 31508376):828. 

Qadeer, Zulekha A; Valle-Garcia, David; Hasson, Dan; Sun, Zhen; Cook, April; Nguyen, Christie; Soriano, Aroa; Ma, Anqi; Griffiths, Lyra M; Zeineldin, Maged; Filipescu, Dan; Jubierre, Luz; Chowdhury, Asif; Deevy, Orla; Chen, Xiang; Finkelstein, David B; Bahrami, Armita; Stewart, Elizabeth; Federico, Sara; Gallego, Soledad; Dekio, Fumiko; Fowkes, Mary; Meni, David; Maris, John M; Weiss, William A; Roberts, Stephen S; Cheung, Nai-Kong V; Jin, Jian; Segura, Miguel F; Dyer, Michael A; Bernstein, Emily. ATRX In-Frame Fusion Neuroblastoma Is Sensitive to EZH2 Inhibition via Modulation of Neuronal Gene Signatures. Cancer Cell. 2019;36(5):512-527.e9. 

Wang, Lei-Ming; Li, Zhuo; Piao, Yue-Shan; Cai, Yan-Ning; Zhang, Li-Yan; Ge, Hai-Jing; Xu, Wei-Wei; Lu, De-Hong. Clinico-neuropathological features of isocitrate dehydrogenase 2 gene mutations in lower-grade gliomas. Chinese Medical Journal. 2019;132(24):2920-2926. 

Enomoto, Toshiyuki; Aoki, Mikiko; Hamasaki, Makoto; Abe, Hiroshi; Nonaka, Masani; Inoue, Tooru; Nabeshima, Kazuki. Midline Glioma in Adults: Clinicopathological, Genetic, and Epigenetic Analysis. Neurologia Medico-Chirurgica. 2020;60(3):136-146. 

Ferreira, Monica Sofia Ventura; Sørensen, Mia Dahl; Pusch, Stefan; Beier, Dagmar; Bouillon, Anne-Sophie; Kristensen, Bjarne Winther; Brümmendorf, Tim Henrik; Beier, Christoph Patrick; Beier, Fabian. Alternative lengthening of telomeres is the major telomere maintenance mechanism in astrocytoma with isocitrate dehydrogenase 1 mutation. Journal Of Neuro-Oncology. 2020;147(1):1-14. 

Leventoux, N; Augustus, M; Azar, S; Riquier, S; Villemin, J P; Guelfi, S; Falha, L; Bauchet, L; Gozé, C; Ritchie, W; Commes, T; Duffau, H; Rigau, V; Hugnot, J P. Transformation Foci in IDH1-mutated Gliomas Show STAT3 Phosphorylation and Downregulate the Metabolic Enzyme ETNPPL, a Negative Regulator of Glioma Growth. Scientific Reports. 2020;10(1):5504. 

Irwan, Ishak D; Karnowski, Heather L; Bogerd, Hal P; Tsai, Kevin; Cullen, Bryan R. Reversal of Epigenetic Silencing Allows Robust HIV-1 Replication in the Absence of Integrase Function. Mbio. 2020;11(3) 

Cantero, Diana; Mollejo, Manuela; Sepúlveda, Juan M; D'Haene, Nicky; Gutiérrez-Guamán, Myriam J; Rodríguez de Lope, Ángel; Fiaño, Concepción; Castresana, Javier S; Lebrun, Laetitia; Rey, Juan A; Salmon, Isabelle; Meléndez, Bárbara; Hernández-Laín, Aurelio. TP53, ATRX alterations, and low tumor mutation load feature IDH-wildtype giant cell glioblastoma despite exceptional ultra-mutated tumors. Neuro-Oncology Advances. 2020;2(1):vdz059. 

Kerstetter-Fogle, Amber E; Harris, Peggy L R; Brady-Kalnay, Susann M; Sloan, Andrew E. Generation of Glioblastoma Patient-Derived Intracranial Xenografts for Preclinical Studies. International Journal Of Molecular Sciences. 2020;21(14) 

George, Sally L; Lorenzi, Federica; King, David; Hartlieb, Sabine; Campbell, James; Pemberton, Helen; Toprak, Umut H; Barker, Karen; Tall, Jennifer; da Costa, Barbara Martins; van den Boogaard, Marlinde L; Dolman, M Emmy M; Molenaar, Jan J; Bryant, Helen E; Westermann, Frank; Lord, Christopher J; Chesler, Louis. Therapeutic vulnerabilities in the DNA damage response for the treatment of ATRX mutant neuroblastoma. Ebiomedicine. 2020;59( 32846370):102971. 

Clay, Michael R; Pinto, Emilia M; Cline, Cynthia; Tran, Quynh T; Lin, Tong; Dyer, Michael A; Shi, Lei; Wu, Huiyun; Pounds, Stanley B; Zambetti, Gerard P; Orr, Brent A; Ribeiro, Raul C. DNA Methylation Profiling Reveals Prognostically Significant Groups in Pediatric Adrenocortical Tumors: A Report From the International Pediatric Adrenocortical Tumor Registry. Jco Precision Oncology. 3( 32923859) 

Casar-Borota, Olivera; Boldt, Henning Bünsow; Engström, Britt Edén; Andersen, Marianne Skovsager; Baussart, Bertrand; Bengtsson, Daniel; Berinder, Katarina; Ekman, Bertil; Feldt-Rasmussen, Ulla; Höybye, Charlotte; Jørgensen, Jens Otto L; Kolnes, Anders Jensen; Korbonits, Márta; Rasmussen, Åse Krogh; Lindsay, John R; Loughrey, Paul Benjamin; Maiter, Dominique; Manojlovic-Gacic, Emilija; Pahnke, Jens; Poliani, Pietro Luigi; Popovic, Vera; Ragnarsson, Oskar; Schalin-Jäntti, Camilla; Scheie, David; Tóth, Miklós; Villa, Chiara; Wirenfeldt, Martin; Kunicki, Jacek; Burman, Pia. Corticotroph Aggressive Pituitary Tumors and Carcinomas Frequently Harbor ATRX Mutations. The Journal Of Clinical Endocrinology And Metabolism. 2021;106(4):1183-1194. 

Egaña, Larraitz; Auzmendi-Iriarte, Jaione; Andermatten, Joaquin; Villanua, Jorge; Ruiz, Irune; Elua-Pinin, Alejandro; Aldaz, Paula; Querejeta, Arrate; Sarasqueta, Cristina; Zubia, Felix; Matheu, Ander; Samprón, Nicolas. Methylation of MGMT promoter does not predict response to temozolomide in patients with glioblastoma in Donostia Hospital. Scientific Reports. 2020;10(1):18445. 

Brondani, Vania Balderrama; Lacombe, Amanda Meneses Ferreira; Mariani, Beatriz Marinho de Paula; Montenegro, Luciana; Soares, Iberê Cauduro; Bezerra-Neto, João Evangelista; Tanno, Fabio Yoshiaki; Srougi, Victor; Chambo, José Luis; Mendonca, Berenice Bilharinho; Almeida, Madson Q; Zerbini, Maria Claudia Nogueira; Fragoso, Maria Candida Barisson Villares. Low Protein Expression of both ATRX and ZNRF3 as Novel Negative Prognostic Markers of Adult Adrenocortical Carcinoma. International Journal Of Molecular Sciences. 2021;22(3) 

Hartlieb, Sabine A; Sieverling, Lina; Nadler-Holly, Michal; Ziehm, Matthias; Toprak, Umut H; Herrmann, Carl; Ishaque, Naveed; Okonechnikov, Konstantin; Gartlgruber, Moritz; Park, Young-Gyu; Wecht, Elisa Maria; Savelyeva, Larissa; Henrich, Kai-Oliver; Rosswog, Carolina; Fischer, Matthias; Hero, Barbara; Jones, David T W; Pfaff, Elke; Witt, Olaf; Pfister, Stefan M; Volckmann, Richard; Koster, Jan; Kiesel, Katharina; Rippe, Karsten; Taschner-Mandl, Sabine; Ambros, Peter; Brors, Benedikt; Selbach, Matthias; Feuerbach, Lars; Westermann, Frank. Alternative lengthening of telomeres in childhood neuroblastoma from genome to proteome. Nature Communications. 2021;12(1):1269. 

Abedi, Armita Armina; Grunnet, Kirsten; Christensen, Ib Jarle; Michaelsen, Signe Regner; Muhic, Aida; Møller, Søren; Hasselbalch, Benedikte; Poulsen, Hans Skovgaard; Urup, Thomas. A Prognostic Model for Glioblastoma Patients Treated With Standard Therapy Based on a Prospective Cohort of Consecutive Non-Selected Patients From a Single Institution. Frontiers In Oncology. 11( 33718145):597587. 

Habiba, Umma; Sugino, Hirokazu; Yordanova, Roumyana; Ise, Koki; Tanei, Zen-Ichi; Ishida, Yusuke; Tanikawa, Satoshi; Terasaka, Shunsuke; Sato, Ken-Ichi; Kamoshima, Yuuta; Katoh, Masahiko; Nagane, Motoo; Shibahara, Junji; Tsuda, Masumi; Tanaka, Shinya. Loss of H3K27 trimethylation is frequent in IDH1-R132H but not in non-canonical IDH1/2 mutated and 1p/19q codeleted oligodendroglioma: a Japanese cohort study. Acta Neuropathologica Communications. 2021;9(1):95. 

Mellai, Marta; Porrini Prandini, Omar; Mustaccia, Aurora; Fogazzi, Valentina; Allesina, Marta; Krengli, Marco; Boldorini, Renzo. Human TERT Promoter Mutations in Atypical and Anaplastic Meningiomas. Diagnostics (Basel, Switzerland). 2021;11(9) 

Hackeng, Wenzel M; Brosens, Lodewijk A A; Kim, Joo Young; O'Sullivan, Roderick; Sung, You-Na; Liu, Ta-Chiang; Cao, Dengfeng; Heayn, Michelle; Brosnan-Cashman, Jacqueline; An, Soyeon; Morsink, Folkert H M; Heidsma, Charlotte M; Valk, Gerlof D; Vriens, Menno R; Nieveen van Dijkum, Els; Offerhaus, G Johan A; Dreijerink, Koen M A; Zeh, Herbert; Zureikat, Amer H; Hogg, Melissa; Lee, Kenneth; Geller, David; Marsh, J Wallis; Paniccia, Alessandro; Ongchin, Melanie; Pingpank, James F; Bahary, Nathan; Aijazi, Muaz; Brand, Randall; Chennat, Jennifer; Das, Rohit; Fasanella, Kenneth E; Khalid, Asif; McGrath, Kevin; Sarkaria, Savreet; Singh, Harkirat; Slivka, Adam; Nalesnik, Michael; Han, Xiaoli; Nikiforova, Marina N; Lawlor, Rita Teresa; Mafficini, Andrea; Rusev, Boris; Corbo, Vincenzo; Luchini, Claudio; Bersani, Samantha; Pea, Antonio; Cingarlini, Sara; Landoni, Luca; Salvia, Roberto; Milione, Massimo; Milella, Michele; Scarpa, Aldo; Hong, Seung-Mo; Heaphy, Christopher M; Singhi, Aatur D. Non-functional pancreatic neuroendocrine tumours: ATRX/DAXX and alternative lengthening of telomeres (ALT) are prognostically independent from ARX/PDX1 expression and tumour size. Gut. 2022;71(5):961-973. 

Bedics, Gábor; Kotmayer, Lili; Zajta, Erik; Hegyi, Lajos László; Brückner, Edit Ágota; Rajnai, Hajnalka; Reiniger, Lilla; Bödör, Csaba; Garami, Miklós; Scheich, Bálint. Germline MUTYH mutations and high-grade gliomas: Novel evidence for a potential association. Genes, Chromosomes & Cancer. 2022;61(10):622-628. 

Li, Jiaming; Cai, Zhenying; Vaites, Laura Pontano; Shen, Ning; Mitchell, Dylan C; Huttlin, Edward L; Paulo, Joao A; Harry, Brian L; Gygi, Steven P. Proteome-wide mapping of short-lived proteins in human cells. Molecular Cell. 2021;81(22):4722-4735.e5. 

Deng, Minying; Luo, Rongkui; Huang, Jie; Luo, Yuanlong; Song, Qi; Liang, Huaiyu; Xu, Chen; Yuan, Wei; Hou, Yingyong. Clinicopathologic features of gastric glomus tumor: A report of 15 cases and literature review. Pathology Oncology Research : Por. 28( 36699621):1610824. 

Ferreyra Vega, Sandra; Olsson Bontell, Thomas; Kling, Teresia; Jakola, Asgeir Store; Carén, Helena. Longitudinal DNA methylation analysis of adult-type IDH-mutant gliomas. Acta Neuropathologica Communications. 2023;11(1):23. 

Heaphy, Christopher M; Bi, Wenya Linda; Coy, Shannon; Davis, Christine; Gallia, Gary L; Santagata, Sandro; Rodriguez, Fausto J. Telomere length alterations and ATRX/DAXX loss in pituitary adenomas. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2020;33(8):1475-1481.