Anti ATRN pAb (ATL-HPA008853)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008853-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ATRN
Alternative Gene Name: DPPT-L, MGCA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027312: 89%, ENSRNOG00000021240: 89%
Entrez Gene ID: 8455
Uniprot ID: O75882
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLLSDILVFTSEQCDAHRSEAACLAAGPGIRCVWNTGSSQCISWALATDEQEEKLKSECFSKRTLDHDRCDQHTDCYSCTANTNDCHWCNDHCVPRNHSCSEGQISIFRYENCPKDNPMYYCNKKTSCRSCALDQNCQWE |
| Gene Sequence | LLLSDILVFTSEQCDAHRSEAACLAAGPGIRCVWNTGSSQCISWALATDEQEEKLKSECFSKRTLDHDRCDQHTDCYSCTANTNDCHWCNDHCVPRNHSCSEGQISIFRYENCPKDNPMYYCNKKTSCRSCALDQNCQWE |
| Gene ID - Mouse | ENSMUSG00000027312 |
| Gene ID - Rat | ENSRNOG00000021240 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ATRN pAb (ATL-HPA008853) | |
| Datasheet | Anti ATRN pAb (ATL-HPA008853) Datasheet (External Link) |
| Vendor Page | Anti ATRN pAb (ATL-HPA008853) at Atlas Antibodies |
| Documents & Links for Anti ATRN pAb (ATL-HPA008853) | |
| Datasheet | Anti ATRN pAb (ATL-HPA008853) Datasheet (External Link) |
| Vendor Page | Anti ATRN pAb (ATL-HPA008853) |
| Citations for Anti ATRN pAb (ATL-HPA008853) – 1 Found |
| Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17. PubMed |