Anti ATRN pAb (ATL-HPA008853)

Atlas Antibodies

SKU:
ATL-HPA008853-25
  • Immunohistochemical staining of human small intestine shows weak cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: attractin
Gene Name: ATRN
Alternative Gene Name: DPPT-L, MGCA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027312: 89%, ENSRNOG00000021240: 89%
Entrez Gene ID: 8455
Uniprot ID: O75882
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLLSDILVFTSEQCDAHRSEAACLAAGPGIRCVWNTGSSQCISWALATDEQEEKLKSECFSKRTLDHDRCDQHTDCYSCTANTNDCHWCNDHCVPRNHSCSEGQISIFRYENCPKDNPMYYCNKKTSCRSCALDQNCQWE
Gene Sequence LLLSDILVFTSEQCDAHRSEAACLAAGPGIRCVWNTGSSQCISWALATDEQEEKLKSECFSKRTLDHDRCDQHTDCYSCTANTNDCHWCNDHCVPRNHSCSEGQISIFRYENCPKDNPMYYCNKKTSCRSCALDQNCQWE
Gene ID - Mouse ENSMUSG00000027312
Gene ID - Rat ENSRNOG00000021240
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ATRN pAb (ATL-HPA008853)
Datasheet Anti ATRN pAb (ATL-HPA008853) Datasheet (External Link)
Vendor Page Anti ATRN pAb (ATL-HPA008853) at Atlas Antibodies

Documents & Links for Anti ATRN pAb (ATL-HPA008853)
Datasheet Anti ATRN pAb (ATL-HPA008853) Datasheet (External Link)
Vendor Page Anti ATRN pAb (ATL-HPA008853)



Citations for Anti ATRN pAb (ATL-HPA008853) – 1 Found
Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17.  PubMed