Anti ATRAID pAb (ATL-HPA051353)

Atlas Antibodies

Catalog No.:
ATL-HPA051353-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: all-trans retinoic acid-induced differentiation factor
Gene Name: ATRAID
Alternative Gene Name: APR3, C2orf28, HSPC013, p18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013622: 79%, ENSRNOG00000006326: 82%
Entrez Gene ID: 51374
Uniprot ID: Q6UW56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQG
Gene Sequence QHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQG
Gene ID - Mouse ENSMUSG00000013622
Gene ID - Rat ENSRNOG00000006326
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATRAID pAb (ATL-HPA051353)
Datasheet Anti ATRAID pAb (ATL-HPA051353) Datasheet (External Link)
Vendor Page Anti ATRAID pAb (ATL-HPA051353) at Atlas Antibodies

Documents & Links for Anti ATRAID pAb (ATL-HPA051353)
Datasheet Anti ATRAID pAb (ATL-HPA051353) Datasheet (External Link)
Vendor Page Anti ATRAID pAb (ATL-HPA051353)