Anti ATRAID pAb (ATL-HPA051353)

Atlas Antibodies

Catalog No.: ATL-HPA051353-25

Protein Description: all-trans retinoic acid-induced differentiation factor
Gene Name: ATRAID
Alternative Gene Name: APR3, C2orf28, HSPC013, p18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013622: 79%, ENSRNOG00000006326: 82%
Entrez Gene ID: 51374
Uniprot ID: Q6UW56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQG
• Gene Sequence: QHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQG
• Gene ID - Mouse: ENSMUSG00000013622
• Gene ID - Rat: ENSRNOG00000006326
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.