Anti ATR pAb (ATL-HPA054320)

Atlas Antibodies

Catalog No.:
ATL-HPA054320-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ATR serine/threonine kinase
Gene Name: ATR
Alternative Gene Name: FRP1, MEC1, SCKL, SCKL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032409: 94%, ENSRNOG00000010027: 95%
Entrez Gene ID: 545
Uniprot ID: Q13535
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVK
Gene Sequence FAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVK
Gene ID - Mouse ENSMUSG00000032409
Gene ID - Rat ENSRNOG00000010027
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATR pAb (ATL-HPA054320)
Datasheet Anti ATR pAb (ATL-HPA054320) Datasheet (External Link)
Vendor Page Anti ATR pAb (ATL-HPA054320) at Atlas Antibodies

Documents & Links for Anti ATR pAb (ATL-HPA054320)
Datasheet Anti ATR pAb (ATL-HPA054320) Datasheet (External Link)
Vendor Page Anti ATR pAb (ATL-HPA054320)