Anti ATPIF1 pAb (ATL-HPA027999)

Atlas Antibodies

SKU: ATL-HPA027999-100

• 
• 
• 

Protein Description: ATPase inhibitory factor 1
Gene Name: ATPIF1
Alternative Gene Name: ATPI, ATPIP, IP, MGC1167, MGC8898
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054428: 71%, ENSRNOG00000013300: 78%
Entrez Gene ID: 93974
Uniprot ID: Q9UII2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRTMQARGFGSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLK
• Gene Sequence: VRTMQARGFGSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLK
• Gene ID - Mouse: ENSMUSG00000054428
• Gene ID - Rat: ENSRNOG00000013300
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATPIF1 pAb (ATL-HPA027999) – 1 Found

Kampf, Caroline; Bergman, Julia; Oksvold, Per; Asplund, Anna; Navani, Sanjay; Wiking, Mikaela; Lundberg, Emma; Uhlén, Mathias; Ponten, Fredrik. A tool to facilitate clinical biomarker studies--a tissue dictionary based on the Human Protein Atlas. Bmc Medicine. 2012;10( 22971420):103.