Anti ATPAF2 pAb (ATL-HPA023329)

Atlas Antibodies

Catalog No.:
ATL-HPA023329-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ATP synthase mitochondrial F1 complex assembly factor 2
Gene Name: ATPAF2
Alternative Gene Name: ATP12, Atp12p, LP3663, MGC29736
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042709: 91%, ENSRNOG00000003719: 93%
Entrez Gene ID: 91647
Uniprot ID: Q8N5M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen QDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKT
Gene Sequence QDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKT
Gene ID - Mouse ENSMUSG00000042709
Gene ID - Rat ENSRNOG00000003719
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATPAF2 pAb (ATL-HPA023329)
Datasheet Anti ATPAF2 pAb (ATL-HPA023329) Datasheet (External Link)
Vendor Page Anti ATPAF2 pAb (ATL-HPA023329) at Atlas Antibodies

Documents & Links for Anti ATPAF2 pAb (ATL-HPA023329)
Datasheet Anti ATPAF2 pAb (ATL-HPA023329) Datasheet (External Link)
Vendor Page Anti ATPAF2 pAb (ATL-HPA023329)