Anti ATPAF2 pAb (ATL-HPA023329)

Atlas Antibodies

Catalog No.: ATL-HPA023329-25

Protein Description: ATP synthase mitochondrial F1 complex assembly factor 2
Gene Name: ATPAF2
Alternative Gene Name: ATP12, Atp12p, LP3663, MGC29736
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042709: 91%, ENSRNOG00000003719: 93%
Entrez Gene ID: 91647
Uniprot ID: Q8N5M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKT
• Gene Sequence: QDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKT
• Gene ID - Mouse: ENSMUSG00000042709
• Gene ID - Rat: ENSRNOG00000003719
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.