Anti ATPAF1 pAb (ATL-HPA044950)

Atlas Antibodies

SKU: ATL-HPA044950-25

• 

Protein Description: ATP synthase mitochondrial F1 complex assembly factor 1
Gene Name: ATPAF1
Alternative Gene Name: ATP11, Atp11p, FLJ22351
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028710: 94%, ENSRNOG00000010169: 95%
Entrez Gene ID: 64756
Uniprot ID: Q5TC12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQN
• Gene Sequence: KGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQN
• Gene ID - Mouse: ENSMUSG00000028710
• Gene ID - Rat: ENSRNOG00000010169
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATPAF1 pAb (ATL-HPA044950) – 1 Found

Brüggemann, Maria; Gromes, Arabella; Poss, Mirjam; Schmidt, Doris; Klümper, Niklas; Tolkach, Yuri; Dietrich, Dimo; Kristiansen, Glen; Müller, Stefan C; Ellinger, Jörg. Systematic Analysis of the Expression of the Mitochondrial ATP Synthase (Complex V) Subunits in Clear Cell Renal Cell Carcinoma. Translational Oncology. 2017;10(4):661-668.