Anti ATPAF1 pAb (ATL-HPA044950)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044950-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ATPAF1
Alternative Gene Name: ATP11, Atp11p, FLJ22351
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028710: 94%, ENSRNOG00000010169: 95%
Entrez Gene ID: 64756
Uniprot ID: Q5TC12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQN |
Gene Sequence | KGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQN |
Gene ID - Mouse | ENSMUSG00000028710 |
Gene ID - Rat | ENSRNOG00000010169 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ATPAF1 pAb (ATL-HPA044950) | |
Datasheet | Anti ATPAF1 pAb (ATL-HPA044950) Datasheet (External Link) |
Vendor Page | Anti ATPAF1 pAb (ATL-HPA044950) at Atlas Antibodies |
Documents & Links for Anti ATPAF1 pAb (ATL-HPA044950) | |
Datasheet | Anti ATPAF1 pAb (ATL-HPA044950) Datasheet (External Link) |
Vendor Page | Anti ATPAF1 pAb (ATL-HPA044950) |
Citations for Anti ATPAF1 pAb (ATL-HPA044950) – 1 Found |
Brüggemann, Maria; Gromes, Arabella; Poss, Mirjam; Schmidt, Doris; Klümper, Niklas; Tolkach, Yuri; Dietrich, Dimo; Kristiansen, Glen; Müller, Stefan C; Ellinger, Jörg. Systematic Analysis of the Expression of the Mitochondrial ATP Synthase (Complex V) Subunits in Clear Cell Renal Cell Carcinoma. Translational Oncology. 2017;10(4):661-668. PubMed |