Anti ATPAF1 pAb (ATL-HPA028382)

Atlas Antibodies

SKU:
ATL-HPA028382-25
  • Immunofluorescent staining of human cell line SiHa shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ATP synthase mitochondrial F1 complex assembly factor 1
Gene Name: ATPAF1
Alternative Gene Name: ATP11, Atp11p, FLJ22351
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028710: 97%, ENSRNOG00000010169: 96%
Entrez Gene ID: 64756
Uniprot ID: Q5TC12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KFDLIWNRAQSCPTFLCALPRREGYEFFVGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEE
Gene Sequence KFDLIWNRAQSCPTFLCALPRREGYEFFVGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEE
Gene ID - Mouse ENSMUSG00000028710
Gene ID - Rat ENSRNOG00000010169
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ATPAF1 pAb (ATL-HPA028382)
Datasheet Anti ATPAF1 pAb (ATL-HPA028382) Datasheet (External Link)
Vendor Page Anti ATPAF1 pAb (ATL-HPA028382) at Atlas Antibodies

Documents & Links for Anti ATPAF1 pAb (ATL-HPA028382)
Datasheet Anti ATPAF1 pAb (ATL-HPA028382) Datasheet (External Link)
Vendor Page Anti ATPAF1 pAb (ATL-HPA028382)