Anti ATP9B pAb (ATL-HPA029364)

Atlas Antibodies

SKU:
ATL-HPA029364-25
  • Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in decidual cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ATPase, class II, type 9B
Gene Name: ATP9B
Alternative Gene Name: ATPIIB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024566: 79%, ENSRNOG00000032039: 78%
Entrez Gene ID: 374868
Uniprot ID: O43861
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTVSYGADTMDEIQSHVRDSYSQMQSQAGGNNTGSTPLRKAQSSAPKVRKSVSSRIHEAVKAIVLCHNVTPVYESRAGVTEETEFAEADQDFSDENR
Gene Sequence GTVSYGADTMDEIQSHVRDSYSQMQSQAGGNNTGSTPLRKAQSSAPKVRKSVSSRIHEAVKAIVLCHNVTPVYESRAGVTEETEFAEADQDFSDENR
Gene ID - Mouse ENSMUSG00000024566
Gene ID - Rat ENSRNOG00000032039
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ATP9B pAb (ATL-HPA029364)
Datasheet Anti ATP9B pAb (ATL-HPA029364) Datasheet (External Link)
Vendor Page Anti ATP9B pAb (ATL-HPA029364) at Atlas Antibodies

Documents & Links for Anti ATP9B pAb (ATL-HPA029364)
Datasheet Anti ATP9B pAb (ATL-HPA029364) Datasheet (External Link)
Vendor Page Anti ATP9B pAb (ATL-HPA029364)