Anti ATP9B pAb (ATL-HPA029364)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029364-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ATP9B
Alternative Gene Name: ATPIIB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024566: 79%, ENSRNOG00000032039: 78%
Entrez Gene ID: 374868
Uniprot ID: O43861
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GTVSYGADTMDEIQSHVRDSYSQMQSQAGGNNTGSTPLRKAQSSAPKVRKSVSSRIHEAVKAIVLCHNVTPVYESRAGVTEETEFAEADQDFSDENR |
Gene Sequence | GTVSYGADTMDEIQSHVRDSYSQMQSQAGGNNTGSTPLRKAQSSAPKVRKSVSSRIHEAVKAIVLCHNVTPVYESRAGVTEETEFAEADQDFSDENR |
Gene ID - Mouse | ENSMUSG00000024566 |
Gene ID - Rat | ENSRNOG00000032039 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ATP9B pAb (ATL-HPA029364) | |
Datasheet | Anti ATP9B pAb (ATL-HPA029364) Datasheet (External Link) |
Vendor Page | Anti ATP9B pAb (ATL-HPA029364) at Atlas Antibodies |
Documents & Links for Anti ATP9B pAb (ATL-HPA029364) | |
Datasheet | Anti ATP9B pAb (ATL-HPA029364) Datasheet (External Link) |
Vendor Page | Anti ATP9B pAb (ATL-HPA029364) |