Anti ATP8B4 pAb (ATL-HPA040254)

Atlas Antibodies

SKU: ATL-HPA040254-25

• 

Protein Description: ATPase, class I, type 8B, member 4
Gene Name: ATP8B4
Alternative Gene Name: ATPIM, KIAA1939
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060131: 67%, ENSRNOG00000031598: 73%
Entrez Gene ID: 79895
Uniprot ID: Q8TF62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CSINGRIYGEVHDDLDQKTEITQEKEPVDFSVKSQADREFQFFDHNLMESIKMGDPKVHEFLR
• Gene Sequence: CSINGRIYGEVHDDLDQKTEITQEKEPVDFSVKSQADREFQFFDHNLMESIKMGDPKVHEFLR
• Gene ID - Mouse: ENSMUSG00000060131
• Gene ID - Rat: ENSRNOG00000031598
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.