Anti ATP8B4 pAb (ATL-HPA040254)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040254-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ATP8B4
Alternative Gene Name: ATPIM, KIAA1939
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060131: 67%, ENSRNOG00000031598: 73%
Entrez Gene ID: 79895
Uniprot ID: Q8TF62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CSINGRIYGEVHDDLDQKTEITQEKEPVDFSVKSQADREFQFFDHNLMESIKMGDPKVHEFLR |
Gene Sequence | CSINGRIYGEVHDDLDQKTEITQEKEPVDFSVKSQADREFQFFDHNLMESIKMGDPKVHEFLR |
Gene ID - Mouse | ENSMUSG00000060131 |
Gene ID - Rat | ENSRNOG00000031598 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ATP8B4 pAb (ATL-HPA040254) | |
Datasheet | Anti ATP8B4 pAb (ATL-HPA040254) Datasheet (External Link) |
Vendor Page | Anti ATP8B4 pAb (ATL-HPA040254) at Atlas Antibodies |
Documents & Links for Anti ATP8B4 pAb (ATL-HPA040254) | |
Datasheet | Anti ATP8B4 pAb (ATL-HPA040254) Datasheet (External Link) |
Vendor Page | Anti ATP8B4 pAb (ATL-HPA040254) |