Anti ATP8B2 pAb (ATL-HPA046680)

Atlas Antibodies

Catalog No.:
ATL-HPA046680-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ATPase, aminophospholipid transporter, class I, type 8B, member 2
Gene Name: ATP8B2
Alternative Gene Name: ATPID, KIAA1137
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060671: 94%, ENSRNOG00000020822: 94%
Entrez Gene ID: 57198
Uniprot ID: P98198
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVLAYKDLDEEYYEEWAERRLQASLAQDSREDRLASIYEEVENNMML
Gene Sequence LVLAYKDLDEEYYEEWAERRLQASLAQDSREDRLASIYEEVENNMML
Gene ID - Mouse ENSMUSG00000060671
Gene ID - Rat ENSRNOG00000020822
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATP8B2 pAb (ATL-HPA046680)
Datasheet Anti ATP8B2 pAb (ATL-HPA046680) Datasheet (External Link)
Vendor Page Anti ATP8B2 pAb (ATL-HPA046680) at Atlas Antibodies

Documents & Links for Anti ATP8B2 pAb (ATL-HPA046680)
Datasheet Anti ATP8B2 pAb (ATL-HPA046680) Datasheet (External Link)
Vendor Page Anti ATP8B2 pAb (ATL-HPA046680)