Anti ATP8B2 pAb (ATL-HPA046680)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046680-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ATP8B2
Alternative Gene Name: ATPID, KIAA1137
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060671: 94%, ENSRNOG00000020822: 94%
Entrez Gene ID: 57198
Uniprot ID: P98198
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LVLAYKDLDEEYYEEWAERRLQASLAQDSREDRLASIYEEVENNMML |
Gene Sequence | LVLAYKDLDEEYYEEWAERRLQASLAQDSREDRLASIYEEVENNMML |
Gene ID - Mouse | ENSMUSG00000060671 |
Gene ID - Rat | ENSRNOG00000020822 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ATP8B2 pAb (ATL-HPA046680) | |
Datasheet | Anti ATP8B2 pAb (ATL-HPA046680) Datasheet (External Link) |
Vendor Page | Anti ATP8B2 pAb (ATL-HPA046680) at Atlas Antibodies |
Documents & Links for Anti ATP8B2 pAb (ATL-HPA046680) | |
Datasheet | Anti ATP8B2 pAb (ATL-HPA046680) Datasheet (External Link) |
Vendor Page | Anti ATP8B2 pAb (ATL-HPA046680) |