Anti ATP8B2 pAb (ATL-HPA046680)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046680-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ATP8B2
Alternative Gene Name: ATPID, KIAA1137
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060671: 94%, ENSRNOG00000020822: 94%
Entrez Gene ID: 57198
Uniprot ID: P98198
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVLAYKDLDEEYYEEWAERRLQASLAQDSREDRLASIYEEVENNMML |
| Gene Sequence | LVLAYKDLDEEYYEEWAERRLQASLAQDSREDRLASIYEEVENNMML |
| Gene ID - Mouse | ENSMUSG00000060671 |
| Gene ID - Rat | ENSRNOG00000020822 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ATP8B2 pAb (ATL-HPA046680) | |
| Datasheet | Anti ATP8B2 pAb (ATL-HPA046680) Datasheet (External Link) |
| Vendor Page | Anti ATP8B2 pAb (ATL-HPA046680) at Atlas Antibodies |
| Documents & Links for Anti ATP8B2 pAb (ATL-HPA046680) | |
| Datasheet | Anti ATP8B2 pAb (ATL-HPA046680) Datasheet (External Link) |
| Vendor Page | Anti ATP8B2 pAb (ATL-HPA046680) |