Anti ATP8A2 pAb (ATL-HPA040033)

Atlas Antibodies

SKU: ATL-HPA040033-25

• 

Protein Description: ATPase, aminophospholipid transporter, class I, type 8A, member 2
Gene Name: ATP8A2
Alternative Gene Name: ATPIB, ML-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021983: 88%, ENSRNOG00000008053: 89%
Entrez Gene ID: 51761
Uniprot ID: Q9NTI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVTYGHFPELAREPSSDDFCRMPPPCSDSCDFDDPRLLKNIEDRHPTAPCIQEFLTLLAVCHTVVPEKDGDN
• Gene Sequence: GVTYGHFPELAREPSSDDFCRMPPPCSDSCDFDDPRLLKNIEDRHPTAPCIQEFLTLLAVCHTVVPEKDGDN
• Gene ID - Mouse: ENSMUSG00000021983
• Gene ID - Rat: ENSRNOG00000008053
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.