Anti ATP8A2 pAb (ATL-HPA040033)

Atlas Antibodies

Catalog No.:
ATL-HPA040033-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ATPase, aminophospholipid transporter, class I, type 8A, member 2
Gene Name: ATP8A2
Alternative Gene Name: ATPIB, ML-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021983: 88%, ENSRNOG00000008053: 89%
Entrez Gene ID: 51761
Uniprot ID: Q9NTI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVTYGHFPELAREPSSDDFCRMPPPCSDSCDFDDPRLLKNIEDRHPTAPCIQEFLTLLAVCHTVVPEKDGDN
Gene Sequence GVTYGHFPELAREPSSDDFCRMPPPCSDSCDFDDPRLLKNIEDRHPTAPCIQEFLTLLAVCHTVVPEKDGDN
Gene ID - Mouse ENSMUSG00000021983
Gene ID - Rat ENSRNOG00000008053
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATP8A2 pAb (ATL-HPA040033)
Datasheet Anti ATP8A2 pAb (ATL-HPA040033) Datasheet (External Link)
Vendor Page Anti ATP8A2 pAb (ATL-HPA040033) at Atlas Antibodies

Documents & Links for Anti ATP8A2 pAb (ATL-HPA040033)
Datasheet Anti ATP8A2 pAb (ATL-HPA040033) Datasheet (External Link)
Vendor Page Anti ATP8A2 pAb (ATL-HPA040033)