Anti ATP6V1H pAb (ATL-HPA023421 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA023421-25
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ATP6V1H over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414295).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H
Gene Name: ATP6V1H
Alternative Gene Name: CGI-11, SFD, SFDalpha, SFDbeta, VMA13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033793: 100%, ENSRNOG00000030862: 100%
Entrez Gene ID: 51606
Uniprot ID: Q9UI12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSE
Gene Sequence PQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSE
Gene ID - Mouse ENSMUSG00000033793
Gene ID - Rat ENSRNOG00000030862
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ATP6V1H pAb (ATL-HPA023421 w/enhanced validation)
Datasheet Anti ATP6V1H pAb (ATL-HPA023421 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ATP6V1H pAb (ATL-HPA023421 w/enhanced validation)