Anti ATP6V1G3 pAb (ATL-HPA028701 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA028701-25

• 

Protein Description: ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3
Gene Name: ATP6V1G3
Alternative Gene Name: ATP6G3, Vma10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026394: 80%, ENSRNOG00000022480: 78%
Entrez Gene ID: 127124
Uniprot ID: Q96LB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYR
• Gene Sequence: AKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYR
• Gene ID - Mouse: ENSMUSG00000026394
• Gene ID - Rat: ENSRNOG00000022480
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.