Anti ATP6V1G1 pAb (ATL-HPA042898)

Atlas Antibodies

SKU: ATL-HPA042898-25

• 
• 

Protein Description: ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1
Gene Name: ATP6V1G1
Alternative Gene Name: ATP6G, ATP6G1, ATP6GL, ATP6J, DKFZp547P234, Vma10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039105: 92%, ENSRNOG00000008163: 95%
Entrez Gene ID: 9550
Uniprot ID: O75348
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEIEQYRLQREKEFKAKEAAALGSRGSCSTEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYR
• Gene Sequence: AEIEQYRLQREKEFKAKEAAALGSRGSCSTEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYR
• Gene ID - Mouse: ENSMUSG00000039105
• Gene ID - Rat: ENSRNOG00000008163
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.